Domain summary

Last updated
2021-05-08
Domain label
conti-choc
Domain extension
club
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Conti-choc.club registered?
A: Conti-choc.club was registered 7 months, 19 hours, 36 minutes, 50 seconds ago on Saturday, May 8, 2021.
Q: When was the WHOIS for Conti-choc.club last updated?
A: The WHOIS entry was last updated 7 months, 19 hours, 36 minutes, 50 seconds ago on Saturday, May 8, 2021.
Q: What are Conti-choc.club's nameservers?
A: DNS for Conti-choc.club is provided by the following nameservers:
  • dns4.p04.nsone.net
  • dns3.p04.nsone.net
  • dns2.p04.nsone.net
  • dns1.p04.nsone.net
  • ns04.squarespacedns.com
  • ns03.squarespacedns.com
  • ns02.squarespacedns.com
  • ns01.squarespacedns.com
Q: Who is the registrar for the Conti-choc.club domain?
A: The domain has been registered at .
Q: What is the traffic rank for Conti-choc.club?
A: Conti-choc.club has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Conti-choc.club each day?
A: Conti-choc.club receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Conti-choc.club resolve to?
A: Conti-choc.club resolves to the IPv4 address 198.185.159.145.
Q: In what country are Conti-choc.club servers located in?
A: Conti-choc.club has servers located in the United States.
Q: What webserver software does Conti-choc.club use?
A: Conti-choc.club is powered by Squarespace webserver.
Q: Who hosts Conti-choc.club?
A: Conti-choc.club is hosted by SQUARESPACE in United States.
Q: How much is Conti-choc.club worth?
A: Conti-choc.club has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Conti-choc.club Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Conti-choc.club Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Conti-choc.club

H1 Headings

1 :
  1. Members' Worldwide Gift Shop

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

2 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Conti-choc.club

sqsslidecontainerdataslidetypepopupoverlayoverlayalignmentlefteaseinoutmstransitionbackgroundcolorinputtypepasswordsqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineauto dataslicetypebuttonsdataslicetypenavigation ul lisocialiconsstyleborder dataslicetypesocialiconssqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleauto dataslicetypebuttonsdataslicetypesocialiconshover thedotshover170ms easeinouttransitionbackgroundcolor 170msdataslicetypesocialiconshover twitterhoverdataslicetypesocialiconshover codependataslicetypemaplightboxcontent formwrapper pshowtracktitle sqsalbumminimal dataslicetypealbumsocialiconssizeextralargesocialiconsstyleregularuseiconfillfffsqsslidewrapperdataslidetypelockscreenuseiconfill1769ffsqsslidewrapperdataslidetypelockscreenuseiconfillff0031sqsslidewrapperdataslidetypelockscreendataslicetypesocialicons tidalpasswordstylerectanglesoundcloudhoverdataslicetypesocialiconshover dribbblehovertrackrsshoversvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregularinputtypesubmitsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover behance3pxsvgsocialwebkittransitionbackgroundcolor 170ms easeinoutmoztransitionbackgroundcolorpinteresthover1pxtracks tracksocialiconssizesmallsocialiconsstylesoliddataslicetypesocialiconshover houzzhoverdataslicetypesocialiconshover pinteresthoverdataslicetypebuttons ul lisqsslidewrapperdataslidetypelockscreenli asqsslidewrapperdataslidetypelockscreen1sdataslicetypesocialiconshover stitchertweetbodydataslicetypetwitternotdatacompoundtype tweetbodydataslicetypesocialiconshover vscohoverstumbleuponhovereaseinoutmstransitionbackgroundcolor 170ms easeinoutotransitionbackgroundcolorarrowiconavisitedsqsslidewrapperdataslidetypelockscreen2s 2ssqsslidewrapperdataslidetypelockscreen responsivewrappernotstackedsocialiconssizesmallsocialiconsstyleregulareaseinouttransitionbackgroundcolor 170msdataslicetypesocialicons tumblrinputtypesubmitsqsslidewrapperdataslidetypelockscreen buttonstyleoutlinedataslicetypesocialicons smugmugsvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovereaseinmoztransitionopacitytweetdisplaynamesqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlined datacompoundtypepopupoverlayaction170msdataslicetypesocialiconshover spotifyeaseinoutotransitionbackgroundcolor 170ms easeinouttransitionbackgroundcolorbuttonshaperoundedcornerssqsslidecontainerdataslidetypepopupoverlaybuttonstyleoutlineulsqsslidewrapperdataslidetypelockscreendataslicetypebuttons li ahoversqsslidewrapperdataslidetypelockscreendataslicetypealbumhover iconwrapperhoverbuttonstyleoutline datacompoundtypepopupoverlayaction2s easeinmoztransitionopacity 2seaseintransitionopacitydataslicetypesocialiconshover vimeoresponsivewrapperstacked dataslicetypebuttonsonlydataslicetypebuttons lisqsslidewrapperdataslidetypelockscreenpasswordstyleunderlined dataslicetypepasswordinputwrapperdataslicetypesocialicons fivehundredpixaudioplayericonsstyleregular dataslicetypealbumsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline datacompoundtypepopupoverlayactiondataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstyleknockout170ms easeinoutmstransitionbackgroundcoloruseiconfille0393esqsslidewrapperdataslidetypelockscreenbuttonstyleoutlinesqsmodallightbox formwrapper inputtypesubmitsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover tumblrdataslicetypesocialiconshover rdiotwitchhoveruseiconfill382110sqsslidewrapperdataslidetypelockscreensvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypelockscreenusebackgroundfillfffsqsslidewrapperdataslidetypelockscreeninstagramimdbdataslicetypesocialiconshover yelpusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsdataslicetypetwittersqsslidewrapperdataslidetypelockscreensqsslicecustomform ahoversqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover twitchhoverdataslicetypesocialiconshover flickrsocialiconssizeextrasmallsocialiconsstylesoliddataslicetypesocialiconshover instagramhoversvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverdataslicetypesocialicons githubeaseinoutotransitionbackgroundcolordataslicetypebodysqsslidewrapperdataslidetypelockscreen dataslicetypebodydataslicetypesocialiconshover applepodcastdataslicetypemap gmstyleccuseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsiconwrapperwidth24pxheight24pxmargin0socialiconscolorstandardsocialiconsstylesolidautoflex1sqsslicealbumplayliststackedgoogleuseiconfill1ea9e1sqsslidewrapperdataslidetypelockscreenspotifyhoverflickrhoverinputtypesubmithoversqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover rsshoverdataslicetypesocialiconshover stumbleupongalleryvideobackgroundmobileli ahoversqsslidewrapperdataslidetypelockscreeniconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstyleknockoutsqsalbumminimal dataslicetypealbum sqsslicealbumplaylistvevohoveruseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleborder dataslicetypesocialicons170ms easeinoutmstransitionbackgroundcolor 170msbuttonstyleoutlinesqsslicedatacontentemptytruedisplaynonesqsslidewrapperdataslidetypelockscreenstitcheruseiconfilleb4924sqsslidewrapperdataslidetypelockscreenlightboxinner lightboxcontentsqssliceplaybuttoniconwrappersqsslidewrapperdataslidetypelockscreensqsslicecustomform spansqsslidewrapperdataslidetypelockscreenuseiconfill1ab7easqsslidewrapperdataslidetypelockscreensvgsocialwebkittransitionbackgroundcolorbuttonstyleraiseddataslicetypesocialiconshover stitcherhover0 0sqsslidewrapperdataslidetypelockscreensqsalbumminimal dataslicetypealbumasqsslidewrapperdataslidetypelockscreen dataslicetypetwitterdataslicetypesocialiconshover linkedinhoverbordercolorsocialiconssizelargesocialiconsstylebordericonwrapperborder2pxmaxwidth600pxsqsslidewrapperdataslidetypelockscreenactionsnotstacked inputwrappernothiddeneaseinoutotransitioncolor2s easeinotransitionopacity 2sgithubiconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstylesolid170ms easeinoutotransitionbackgroundcolor 170ms8pxsocialiconsstylesolid dataslicetypesocialiconshover iconwrappertweetavatarusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshovericonwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstylesoliddataslicetypesocialiconshover facebookhoverdataslicetypesocialicons youtube170ms easeoutopacity 170mstidalresponsivewrapperstacked dataslicetypebuttons ulactionsstacked inputwrapperdataslicetypesocialicons stumbleuponuseiconfill00b4b3sqsslidewrapperdataslidetypelockscreen170ms easeinouttwitterdataslicetypesocialiconshoversocialiconssizeextrasmallsocialiconsstyleknockoutsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleraiseddataslicetypesocialicons meetupdataslicetypesocialiconshover githubiconwrappersqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebody psocialiconsstyleregular dataslicetypesocialiconsall and maxwidth600pxsqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlineduseiconfillrgba2552552554sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolidiconwrapperwidth36pxheight36pxmargin0audioplayericonsstyleknockouttwitterhoverbuttonstylesolidsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleautodataslicetypesocialicons redditdataslicetypesocialiconshover vscosmugmughoversqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackedsocialstacked dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreensocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverdataslicetypesocialiconshover soundcloud01ssocialiconsstylesolid dataslicetypesocialiconshover iconwrapperhoverdataslicetypesocialicons stitcherdataslicetypesocialiconshover googlehovereaseinotransitionopacity 2slisqsslidewrapperdataslidetypelockscreenhouzzdataslicetypesocialiconshover applepodcasthoversqsslidelayercontent2em 0pxuseiconfill35465dsqsslidewrapperdataslidetypelockscreenactionsstackeddatacompoundtypepopupoverlayactiondataslicetypesocialiconshover redditgooglehovercountdowncontentdataformattextual0msuseiconfill0976b4sqsslidewrapperdataslidetypelockscreen2em 0px 0pxrssmeetupstumbleuponlinkedinhovertumblrmediumsqsslicecustomformdataslicetypesocialiconshover smugmughoverdataslicetypesocialiconshover emaildataslicetypesocialicons twitterdataslicetypesocialiconshover thedotsdataslicetypesocialicons rdioitunesdataslicetypesocialiconshover smugmugdataslicetypesocialiconshover yelphovertidalhovereaseinmoztransitionopacity 2sulstackeddataslicetypesocialiconshover reddithoverdataslicetypesocialiconshover imdbhoveractionssqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover flickrhoverdataslicetypesocialiconshover emailhoversocialiconssizesmallsocialiconsstylebordersqssliceplaybuttoniconwrapperhoversqsslidecontainerdataslidetypepopupoverlayenableoverlaycontentborderdataslicetypesocialiconshover githubhoverdataslicetypenavigation uldataslicetypealbum sqsslicealbumplaylist tracksresponsivewrapperstackedul lidataslicetypesocialiconshover houzzeaseoutopacity 170mssocialiconssizeextralargesocialiconsstyleborderbordercolor 170mssvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolidbandsintownhoversocialiconscolorstandardsocialiconsstyleregulardataslicetypesocialiconshover snapchathoverdataslicetypesocialicons vevouseiconfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregular7pxusemaskfillrgba3434344sqsslidewrapperdataslidetypelockscreenbuttonsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlineinputtypetextsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypesocialiconshover iconwrapperhover6pxcodepengmstyleccdataslicetypesocialiconshover tidalhovereaseinotransitionopacityvscouseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockoutdataslicetypesocialicons pinterestsqsalbumminimalspotifydataslicetypealbum iconwrappersqsslicealbumplaylistplayingsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled datacompoundtypepopupoverlayactionsocialiconssizeextralargesocialiconsstyleknockoutasqsslidewrapperdataslidetypelockscreen buttonstyleoutlineuseiconfillrgba2552552554sqsslidewrapperdataslidetypelockscreenliaudioplayericonsstylesolid dataslicetypealbumhoverallbandsintowniconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstylesoliddataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstyleknockoutsqsmodallightboxcontentfffsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover vimeohovervideoiconstylesolidsnapchateaseinoutotransitionbackgroundcolor 170msp ahoversqsslidewrapperdataslidetypelockscreenahoversqsslidewrapperdataslidetypelockscreensocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconsdataslicetypesocialicons dropboxdataslicetypesocialicons vimeoiconwrapperhoverbehancesqsslidesqsslideanimationreadydataslicetypenavigationdataslicetypesocialicons houzzdataslicetypesocialicons snapchatformitemsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline2s easeinmstransitionopacityuseiconfill8c8070sqsslidewrapperdataslidetypelockscreenfielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25em 5emfont14pxdataslicetypecountdown countdowncontentdataformattextual countdownunituseiconfill5adfcbsqsslidewrapperdataslidetypelockscreeneaseinouttransitionbackgroundcoloruseiconfilldc4e41sqsslidewrapperdataslidetypelockscreenlockstyleborder dataslicetypelocksqsslidewrapperdataslidetypelockscreen dataslicetypecountdown countdowncontentdataformatnumeric2s easeintransitionopacitysquarespacehoversvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconsdataslicetypebuttons asqsslidewrapperdataslidetypelockscreensocialiconsstyleknockoutlightboxcontent formwrapperaudioplayericonsstyleborder dataslicetypealbumdataslicetypesocialiconshover itunesdataslicetypesocialiconshover fivehundredpixuseiconfille6b91esqsslidewrapperdataslidetypelockscreendataslicetypealbum iconwrapperlastchildmarginright0sqsslidewrapperdataslidetypelockscreenemailhoverdataslicetypetwitternotdatacompoundtype tweettimestampdataslicetypealbum sqsslicealbumplaylistdataslicetypesocialiconshover linkedinthedotshoveruseiconfille52d27sqsslidewrapperdataslidetypelockscreendataslicetypebodysqsslidewrapperdataslidetypelockscreendataslicetypesocialicons codependataslicetypetwitter tweetavatardataslicetypesocialiconshover dropboxhovereaseinoutmoztransitionbackgroundcolor 170msdataslicetypesocialicons thedots2s easeinmstransitionopacity 2simdbhoveruseiconfill007ee5sqsslidewrapperdataslidetypelockscreeneaseoutopacitysvgsocialwebkittransitionbackgroundcolor 170msdribbblehoveruseiconfill6441a5sqsslidewrapperdataslidetypelockscreenerrormessagesqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover foursquareusemaskfilltransparentsqsslidewrapperdataslidetypelockscreenusemaskfill222sqsslidewrapperdataslidetypelockscreeneaseinmstransitionopacitysqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutlineul lisqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestacked inputwrapperdataslicetypesocialicons twitchsocialiconssizelargesocialiconsstyleregularyoutubelockstyleregularbuttonsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackedyelphover2sdataslicetypebodydataslicetypesocialiconshover ituneshoverscreensqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttonsinputtypesubmitsqsslidewrapperdataslidetypelockscreen buttonstyleoutline datacompoundtypepopupoverlayactionfacebookhoverdataslicetypesocialiconshover rdiohoverpinterestdataslicetypebuttons ahoversqsslidewrapperdataslidetypelockscreen170ms easeinoutmoztransitionbackgroundcolor 170mssqsslidecontainerdataslidetypepopupoverlayoverlayalignmentcenterdataslicetypesocialiconshover facebookgoogleplayhoversocialiconssizesmallsocialiconsstyleknockoutsnapchathoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstylesoliddataslicetypesocialiconshover googlevinehovertweethandledataslicetypesocialiconshover stumbleuponhoverdataslicetypebuttons li asqsslidewrapperdataslidetypelockscreendataslicetypealbum sqsslicealbumplaylistdemoalbumdataslicetypesocialiconshover mediumhoveruseiconfillea4c89sqsslidewrapperdataslidetypelockscreendataslicetypealbumuseiconfillc41200sqsslidewrapperdataslidetypelockscreentweettimestamp0px 0pxdataslicetypesocialicons vscodataslicetypealbum tracktitleasqsslidewrapperdataslidetypelockscreenshowtracktitle sqsalbumminimalbuttonstyleoutlinesqsmodallightboxredditsocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsdataslicetypesocialiconshover medium10pxuseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleborderdataslicetypesocialicons svgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons squarespaceeaseinoutmstransitionbackgroundcolor 170mssocialiconsstylebordersqsslidecontainerdataslidetypepopupoverlaydataslicetypesocialicons soundcloudcountdowncontentdataformatnumericiconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstylesoliddataslicetypesocialiconshover vevohoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstyleknockoutuseiconfill7ac143sqsslidewrapperdataslidetypelockscreensocialiconsstylesolidsocialiconssizeextrasmallsocialiconsstyleborderdataslicetypesocialiconshover tidallockstyleregular dataslicetypelockuseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolidusemaskfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverdataslicetypebuttons ulstackeduseiconfilltransparentsqsslidewrapperdataslidetypelockscreeneaseinmstransitionopacity 2ssqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrappergoogleplaysqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttons liapplepodcastdataslicetypesocialicons itunesdataslicetypebuttonsinputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypelockscreendatacompoundtypepopupoverlayaction inputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypelockscreenstitcherhovertwitchsocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconsuseiconfillff4500sqsslidewrapperdataslidetypelockscreenyelp170ms easeinoutsqsslidewrapperdataslidetypelockscreen170ms easeinoutotransitionbackgroundcolorp asqsslidewrapperdataslidetypelockscreendataslicetypetwitternotdatacompoundtypesocialiconssizemediumsocialiconsstyleknockoutdataslicetypesocialiconshover bandsintownsqsmodallightboxinstagramhoverdataslicetypesocialiconshover goodreads5pxsocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshover5emfont14pxfivehundredpixhoverdataslicetypebuttons ul lidataslicetypegallerysqsgallerygridlightboxinner lightboxcontent formwrapperuseiconfillae995asqsslidewrapperdataslidetypelockscreenbuttontypesubmitsqsslidewrapperdataslidetypelockscreenlightboxinnerapplepodcasthoverlightboxcontentdataslicetypesocialicons vinedataslicetypegalleryuseiconfillrgba3434344sqsslidewrapperdataslidetypelockscreendataslicetypesocialicons goodreadslockstylesolidusebackgroundfilltransparentsqsslidewrapperdataslidetypelockscreenvideoiconstyleknockoutsocialstackedtextalignleft dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreenflickrlockstyleknockoutaudioplayericonsstyleregular170ms easeinouttransitionbackgroundcolor1sqsmodallightboxopenuseiconfill006ed2sqsslidewrapperdataslidetypelockscreendataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstylesoliddataslicetypesocialiconshover soundcloudhovervideoiconstyleborderdataslicetypepassword inputtypepasswordsqsslidewrapperdataslidetypelockscreenimportantsqsslidewrapperdataslidetypelockscreen sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinesocialiconssizelargesocialiconsstyleknockoutdataslicetypesocialicons behancedataslicetypesocialicons googleplay2s easeinotransitionopacitysqsslicecustomform asqsslidewrapperdataslidetypelockscreenpasswordstylerectangle dataslicetypepassworddataslicetypesocialiconshover vinesqsalbumminimal dataslicetypealbum sqsslicealbumplayliststackedsqsslicealbumplaylistdataslicetypesocialiconshover youtubehoverbuttonstyleoutlinesqsmodallightbox formwrapperresponsivewrapperdisclaimercontainersqsslidewrapperdataslidetypelockscreendataslicetypesocialicons instagramdataslicetypesocialiconshover goodreadshoversqsmodallightboxcontent lightboxinner lightboxcontentsocialstackedtextalignleftbordercolor 170ms easeinoutsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons usemaskfilltransparentsqsslidewrapperdataslidetypelockscreensqsslicecustomformsqsslidewrapperdataslidetypelockscreenuseiconfill0063dcsqsslidewrapperdataslidetypelockscreensqsslidewrapperdataslidetypelockscreen dataslicetypecountdownbuttonshapepillactionsnotstackeddataslicetypesocialicons googleonly screendataslicetypesocialiconshover codepenhoverdataslicetypealbum trackprogressbardataslicetypesocialiconshover imdbdataslicetypesocialiconshover twitchsqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutlinespansqsslidewrapperdataslidetypelockscreensocialiconssizemediumsocialiconsstyleregularsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebodysqsslidecontainerdataslidetypepopupoverlay captchacontainerwrapper2s easeintransitionopacity 2ssqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangleiconwrapperdataslicetypebody p0socialstackeddataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstyleknockoutuseiconfillf94877sqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover meetupdataslicetypesocialiconshover twitteryoutubehoverdribbbleresponsivewrapperstacked sqsslicecustomformsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinline dataslicetypebuttonsfacebook0ms 0msbuttonstyleoutline dataslicetypebuttonsdataslicetypealbum iconwrappersqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover foursquarehoveraudioplayericonsstylebordersqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestackeddataslicetypesocialicons dribbbleuseiconfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoversvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreenvine2emusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolideaseinouttransitioncolorsqsslidewrapperdataslidetypelockscreen dataslicetypebuttonsdataslicetypecountdown countdowncontentdataformattextualdataslicetypebuttons ul100mssqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangle datacompoundtypepopupoverlayactionsocialiconscolorstandardsocialiconsstyleknockoutuseiconfill222sqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover behancehoveruseiconfillec4652sqsslidewrapperdataslidetypelockscreencountdownunitdataslicetypealbum iconwrapperlastchildsqsslidewrapperdataslidetypelockscreensocialiconssizelargesocialiconsstylesolidfivehundredpixdataslicetypesocialicons mediumrdiohoverdataslicetypebuttons ulsqsslidewrapperdataslidetypelockscreeneaseinouttransitionbackgroundcolor 170ms easeinoutsqsslidewrapperdataslidetypelockscreenusemaskfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockoutgmnoprintsqssliceplaybuttoniconwrappersocialiconssizemediumsocialiconsstylesoliddataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstylesoliddataslicetypesocialicons rssimportantsqsslidewrapperdataslidetypelockscreen sqsslidecontainernotautoimagebackgroundcolor170ms easeoutopacityuseiconfill84bd00sqsslidewrapperdataslidetypelockscreendataslicetypemap gmnoprintgalleryvideobackgroundul li asqsslidewrapperdataslidetypelockscreenuseiconfill222backgroundcolor222sqsslidewrapperdataslidetypelockscreeniconwrapperdivwebkittransformscale2moztransformscale2mstransformscale2transformscale2sqsslidewrapperdataslidetypelockscreentrackprogressbarvevoeaseinoutmoztransitionbackgroundcolor 170ms easeinoutmstransitionbackgroundcolorformwrapper pituneshoveruseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconsemailiconwrapperlastchildsqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlay datacompoundtypepopupoverlayactiondataslicetypealbum sqsslicealbumplayliststackedhouzzhoverdataslicetypeheadingnotdatacompoundtypedataslicetypesocialiconsdataslicetypesocialiconshover tumblrhoveruseiconfill000sqsslidewrapperdataslidetypelockscreendropboxdataslicetypesocialiconshover squarespacehoverdataslicetypesocialiconshover rssdropboxhoversocialiconsstylesolid dataslicetypesocialiconsdataslicetypesocialiconshover dribbble2s easesqsslidewrapperdataslidetypelockscreeniconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextrasmallsocialiconsstylesolideasesqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutline datacompoundtypepopupoverlayactioniconwrapperwidth28pxheight28pxmargin0importantsqsslidewrapperdataslidetypelockscreenformwrapper inputtypesubmithoversqsslidewrapperdataslidetypelockscreendataslicetypesocialicons foursquarefoursquarehoverdataslicetypepasswordmediumhoversocialiconssizemediumsocialiconsstylebordereaseinoutsqsslidewrapperdataslidetypelockscreen socialiconsstylesolidbuttonsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover vevopasswordstyleunderlined0sqsslidewrapperdataslidetypelockscreendataslicetypelockiconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstyleknockoutlockstyleborderdataslicetypesocialicons imdbuseiconfillcc2127sqsslidewrapperdataslidetypelockscreensocialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconssqsalbumminimal dataslicetypealbum sqsslicealbumplaylistdemoalbumuseiconfille4405fsqsslidewrapperdataslidetypelockscreendataslicetypealbumhoversolidsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolidsoundcloudtracktitlesqsslidecontainerdataslidetypepopupoverlayoverlayloadanimationslideindataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreensocialiconsstylesolid dataslicetypesocialiconshoversqsmodallightboxcontent lightboxinnerdataslicetypegallery galleryvideobackgrounddataslicetypealbum sqsslicealbumplaylistplayingdataslicetypesocialicons bandsintowndataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstylesolidscreen and maxwidth600pxsqsslidewrapperdataslidetypelockscreenlockstylesolid dataslicetypelockuseiconfillfffsqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovereaseinout bordercolortumblrhoverdataslicetypesocialiconshover meetuphovereaseinoutlockstyleknockout dataslicetypelockdatacompoundtypepopupoverlayaction buttontypesubmitsqsslidewrapperdataslidetypelockscreenall and maxwidth1020pxsqsslidewrapperdataslidetypelockscreenlinkedinsocialstacked dataslicetypesocialiconsformwrapper inputtypesubmitsqsslidewrapperdataslidetypelockscreen buttonstyleoutlinegoodreadshoversocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovertracksformitemsqsslidewrapperdataslidetypelockscreenulrdiodataslicetypecountdownformwrapper inputtypesubmitsqsslidewrapperdataslidetypelockscreendataslicetypesocialicons facebookuseiconfillrgba2552552554sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshover0pxfielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25emformwrapperdataslicetypebuttons liuseiconfill7dbb00sqsslidewrapperdataslidetypelockscreenuseiconfill0099e5sqsslidewrapperdataslidetypelockscreeninputwrappernothiddendataslicetypegallery galleryvideobackgroundmobileusemaskfillrgba3434344sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleknockoutbuttonplaypauseshowtracktitledataslicetypesocialiconshover googleplayhoverresponsivewrappernotstackeddataslicetypesocialicons emailuseiconfill55aceesqsslidewrapperdataslidetypelockscreenvimeogithubhoveruseiconfill00ab6csqsslidewrapperdataslidetypelockscreensvgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenableduseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregularsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstacked inputwrappernothiddendataslicetypealbumhover iconwrapperdataslicetypesocialiconshover snapchatsqsslicealbumplaylist trackssqsslidecontainernotautoimagebackgroundcolorfoursquarepsocialiconscolorstandardsocialiconsstyleborderdataslicetypebuttonssqsslidewrapperdataslidetypelockscreenuseiconfill3b5998sqsslidewrapperdataslidetypelockscreenactionsstacked inputwrappernothiddendataslicetypesocialiconshover spotifyhoversocialiconssizeextralargesocialiconsstylesolideaseinoutmoztransitionbackgroundcolorinputtypetextsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover pinterestresponsivewrapperstacked dataslicetypenavigationcountdowncontentdataformattextual countdownuniticonwrappersqsslidewrapperdataslidetypelockscreen socialiconssizemediumsocialiconsstyleknockoutsmugmugdataslicetypecountdown countdowncontentdataformatnumericdataslicetypelock usebackgroundfilltransparentsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover squarespace170ms easeinoutmoztransitionbackgroundcolorsqsslicealbumplaylistdemoalbumvimeohover14pxdataslicetypesocialicons linkedinuseiconfillf60sqsslidewrapperdataslidetypelockscreeneaseinout bordercolor 170msdataslicetypesocialiconshover dropboxdataslicetypesocialicons flickrsocialiconsstyleregulardataslicetypesocialicons spotifyuseiconfill00b488sqsslidewrapperdataslidetypelockscreeneaseinoutsqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover iconwrapperdatacompoundtypepopupoverlayaction errormessagesqsslidewrapperdataslidetypelockscreenasqsslidewrapperdataslidetypelockscreen buttonstyleoutline sqsslicecustomformiconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstyleknockouticonwrapperwidth32pxheight32pxmargin0iconwrapperlastchildmarginright0sqsslidewrapperdataslidetypelockscreensqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinesquarespaceeaseinoutmstransitioncoloruseiconfill4183c4sqsslidewrapperdataslidetypelockscreenvscohoverdataslicetypesocialicons yelpresponsivewrapperstacked dataslicetypenavigation uluseiconfill222sqsslidewrapperdataslidetypelockscreen socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshover4pxbuttonstyleoutline sqsslicecustomformaudioplayericonsstylesolidvideoiconstyleregularsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstackedsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlinecodepenhover170ms easeinout bordercolormaxwidth1020pxsqsslidewrapperdataslidetypelockscreendisplaytablesqsslidewrapperdataslidetypelockscreeniconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizesmallsocialiconsstyleknockoutthedotssqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrappernothiddensocialiconsstyleknockout dataslicetypesocialiconsdataslicetypesocialicons applepodcastbehancehoverdatacompoundtypepopupoverlayaction inputtypetextsqsslidewrapperdataslidetypelockscreenreddithoverdataslicetypepassword arrowiconsocialstackedtextalignleft dataslicetypesocialicons2s easeinmoztransitionopacitydataslicetypesocialiconshover fivehundredpixhoverdataslicetypesocialiconshover bandsintownhoversqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineautomapstyleminimaldarkeaseintransitionopacity 2sdataslicetypesocialiconshover googleplaydataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizelargesocialiconsstylesolidautosqsslidewrapperdataslidetypelockscreendataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypelockscreen socialiconssizeextralargesocialiconsstyleknockoutsocialiconssizeextrasmallsocialiconsstyleregularresponsivewrapperstackedtextaligncentermeetuphovercaptchacontainerwrappersqsslicealbumplaylist tracks trackdataslicetypesocialiconshover vinehoveradisplayblocksqsslidewrapperdataslidetypelockscreendataslicetypesocialiconshover youtubegoodreadseaseinoutmoztransitioncolordataslicetypesocialiconshover instagram

Longtail Keyword Density for Conti-choc.club

KeywordsOccurences
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
sqs-modal-lightbox-content lightbox-inner lightbox-content19
170ms ease-in-out border-color15
ease-in-out border-color 170ms15
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlist14
lightbox-inner lightbox-content form-wrapper14
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons12
data-slice-typealbum sqs-slice-album-playlist tracks11
socialstacked data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
socialstackedtext-align-left data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
170ms ease-in-outtransitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-out-moz-transitionbackground-color 170ms8
sqs-slice-album-playlist tracks track7
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons6
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons6
show-track-title sqs-album-minimal data-slice-typealbum6
ease-in-out-ms-transitionbackground-color 170ms ease-in-out-o-transitionbackground-color6
ease-in-out-moz-transitionbackground-color 170ms ease-in-out-ms-transitionbackground-color6
ease-in-outtransitionbackground-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typelock-screen6
ease-in-out-o-transitionbackground-color 170ms ease-in-outtransitionbackground-color6
2em 0px 0px6
data-slice-typenavigation ul li5
data-slice-typebuttons li asqs-slide-wrapperdata-slide-typelock-screen5
all and max-width600pxsqs-slide-wrapperdata-slide-typelock-screen5
170ms ease-outopacity 170ms5
svgsocial-webkit-transitionbackground-color 170ms ease-in-out-moz-transitionbackground-color4
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapperhover4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody p4
lightbox-content form-wrapper p4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons li4
data-slice-typebuttons ul lisqs-slide-wrapperdata-slide-typelock-screen4
data-slice-typebuttons ul li4
responsive-wrapperstacked data-slice-typenavigation ul4
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked input-wrappernothidden4
buttonsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked3
data-slice-typebuttons li ahoversqs-slide-wrapperdata-slide-typelock-screen3
inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen button-style-outline data-compound-typepopup-overlay-action3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrapper3
all and max-width1020pxsqs-slide-wrapperdata-slide-typelock-screen3
sqs-slide-wrapperdata-slide-typelock-screen data-slice-typecountdown countdown-contentdata-formatnumeric3
data-slice-typecountdown countdown-contentdata-formattextual countdown-unit3
button-style-outlinesqs-modal-lightbox form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen3
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapper3
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen button-style-outline3
responsive-wrapperstacked data-slice-typebuttons ul3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-solid3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playliststacked3
ul li asqs-slide-wrapperdata-slide-typelock-screen3
2s ease-in-moz-transitionopacity 2s3
2s ease-in-ms-transitionopacity 2s3
2s ease-in-o-transitionopacity 2s3
2s ease-intransitionopacity 2s3
border-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typelock-screen3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlistdemo-album3
screen and max-width600pxsqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-knockout3
asqs-slide-wrapperdata-slide-typelock-screen button-style-outline sqs-slice-custom-form3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-solid3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrappernothidden3
social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons176
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover176
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover88
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover88
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons88
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid88
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid44
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout44
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons44
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typelock-screen34
sqs-album-minimal data-slice-typealbum25
sqs-modal-lightbox-content lightbox-inner21
socialstacked data-slice-typesocial-icons20
socialstackedtext-align-left data-slice-typesocial-icons20
lightbox-inner lightbox-content19
data-slice-typecountdown countdown-contentdata-formatnumeric18
border-color 170ms15
170ms ease-in-out15
data-slice-typealbum sqs-slice-album-playlist15
ease-in-out border-color15
lightbox-content form-wrapper14
data-slice-typegallery gallery-video-background14
170ms ease-in-outsqs-slide-wrapperdata-slide-typelock-screen13
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked12
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-border12
data-slice-typebuttons ul12
sqs-slide-containerdata-slide-typepopup-overlay data-compound-typepopup-overlay-action12
0 0sqs-slide-wrapperdata-slide-typelock-screen11
sqs-slice-album-playlist tracks11
data-slice-typecountdown countdown-contentdata-formattextual11
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked11
data-slice-typealbum icon-wrapper11
data-slice-typealbum icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typelock-screen10
data-slice-typenavigation ul10
password-style-underlined data-slice-typepassword10
data-slice-typebuttons li10
data-slice-typealbum icon-wrapperlast-childsqs-slide-wrapperdata-slide-typelock-screen10
data-slice-typealbum icon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
ul li9
password-style-rectangle data-slice-typepassword9
data-slice-typebody p8
170ms ease-in-outtransitionbackground-color8
ease-in-outtransitionbackground-color 170ms8
ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color8
ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color8
ease-in-out-moz-transitionbackground-color 170ms8
social-icons-style-solid data-slice-typesocial-iconshover8
data-slice-typebuttons asqs-slide-wrapperdata-slide-typelock-screen8
li asqs-slide-wrapperdata-slide-typelock-screen8
170ms ease-in-out-moz-transitionbackground-color8
sqs-slice-custom-form asqs-slide-wrapperdata-slide-typelock-screen7
button-style-outlinesqs-modal-lightbox form-wrapper7
show-track-title sqs-album-minimal7
tracks track7
social-icons-style-border data-slice-typesocial-icons7
button-style-outline data-compound-typepopup-overlay-action7
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid6
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-solid6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout6
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-knockout6
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen6
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular6
button-style-outline sqs-slice-custom-form6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen social-icons-color-standardsocial-icons-style-regular6
audio-player-icons-style-border data-slice-typealbum6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle data-compound-typepopup-overlay-action6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline data-compound-typepopup-overlay-action6
data-slice-typealbum track-progress-bar6
data-slice-typesocial-iconshover icon-wrapperhover6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-compound-typepopup-overlay-action6
0px 0px6
2em 0px6
data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typelock-screen6
button-style-outline data-slice-typebuttons6
data-slice-typesocial-icons rss5
data-slice-typesocial-icons meetup5
data-slice-typesocial-icons pinterest5
data-slice-typesocial-icons medium5
data-slice-typesocial-icons smugmug5
data-slice-typesocial-icons reddit5
data-slice-typesocial-icons linkedin5
data-slice-typesocial-icons snapchat5
data-slice-typesocial-icons itunes5
data-slice-typesocial-icons dribbble5
data-slice-typesocial-icons twitch5
data-slice-typesocial-icons dropbox5
data-slice-typesocial-icons instagram5
data-slice-typesocial-icons tumblr5
data-slice-typesocial-icons stitcher5
data-slice-typesocial-icons google5
data-slice-typesocial-icons googleplay5
responsive-wrapperstacked data-slice-typebuttons5
data-slice-typesocial-icons goodreads5
data-slice-typesocial-icons houzz5
data-slice-typesocial-icons imdb5
data-slice-typesocial-icons soundcloud5
data-slice-typesocial-icons github5
data-slice-typesocial-icons squarespace5
data-slice-typesocial-icons stumbleupon5
data-slice-typesocial-icons foursquare5
data-slice-typesocial-icons flickr5
data-slice-typesocial-icons thedots5
data-slice-typesocial-icons fivehundredpix5
data-slice-typesocial-icons tidal5
data-slice-typesocial-icons facebook5
data-slice-typesocial-icons email5
data-slice-typesocial-icons spotify5
data-slice-typesocial-icons vimeo5
data-slice-typesocial-icons rdio5
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody5
asqs-slide-wrapperdata-slide-typelock-screen button-style-outline5
sqs-slide-wrapperdata-slide-typelock-screen data-slice-typebuttons5
data-slice-typesocial-icons yelp5
data-slice-typesocial-iconshover icon-wrapper5
0ms 0ms5
data-slice-typealbum sqs-slice-album-playlistplaying5
data-slice-typesocial-icons vsco5
lock-style-regular data-slice-typelock5
data-slice-typebodysqs-slide-wrapperdata-slide-typelock-screen data-slice-typebody5
2s 2s5
data-slice-typesocial-icons youtube5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined data-compound-typepopup-overlay-action5
data-slice-typesocial-icons vine5
data-slice-typesocial-icons bandsintown5
170ms ease-outopacity5
data-slice-typesocial-icons codepen5
data-slice-typesocial-icons applepodcast5
ease-outopacity 170ms5
data-slice-typesocial-icons twitter5
ul lisqs-slide-wrapperdata-slide-typelock-screen5
responsive-wrapperstacked data-slice-typenavigation5
data-slice-typesocial-icons behance5
data-slice-typesocial-icons vevo5
data-slice-typesocial-iconshover soundcloud4
data-slice-typesocial-iconshover youtube4
data-slice-typesocial-iconshover youtubehover4
data-slice-typesocial-iconshover soundcloudhover4
data-slice-typesocial-iconshover rsshover4
data-slice-typesocial-iconshover reddit4
data-slice-typesocial-iconshover rss4
data-slice-typesocial-iconshover snapchathover4
data-slice-typesocial-iconshover snapchat4
form-wrapper p4
data-slice-typesocial-iconshover reddithover4
data-slice-typesocial-iconshover smugmughover4
data-slice-typesocial-iconshover smugmug4
data-slice-typesocial-iconshover spotify4
data-slice-typesocial-iconshover twitchhover4
data-slice-typesocial-iconshover spotifyhover4
data-slice-typesocial-iconshover thedotshover4
data-slice-typesocial-iconshover twitter4
data-slice-typesocial-iconshover twitterhover4
data-slice-typesocial-iconshover vevo4
data-slice-typesocial-iconshover vevohover4
data-slice-typesocial-iconshover tumblrhover4
data-slice-typesocial-iconshover tumblr4
data-slice-typesocial-iconshover rdiohover4
data-slice-typesocial-iconshover vimeo4
data-slice-typesocial-iconshover tidalhover4
data-slice-typesocial-iconshover tidal4
data-slice-typesocial-iconshover vimeohover4
data-slice-typesocial-iconshover vine4
data-slice-typesocial-iconshover yelphover4
data-slice-typesocial-iconshover thedots4
data-slice-typesocial-iconshover vinehover4
data-slice-typesocial-iconshover stumbleuponhover4
data-slice-typesocial-iconshover stumbleupon4
data-slice-typesocial-iconshover vsco4
data-slice-typesocial-iconshover stitcherhover4
data-slice-typesocial-iconshover vscohover4
data-slice-typesocial-iconshover stitcher4
data-slice-typesocial-iconshover twitch4
data-slice-typesocial-iconshover squarespacehover4
data-slice-typesocial-iconshover squarespace4
data-slice-typesocial-iconshover yelp4
data-slice-typesocial-iconshover googlehover4
data-slice-typesocial-iconshover rdio4
social-icons-style-regular data-slice-typesocial-icons4
data-slice-typesocial-iconshover dropboxhover4
data-slice-typesocial-iconshover dropbox4
data-slice-typesocial-iconshover dribbblehover4
data-slice-typesocial-iconshover dribbble4
data-slice-typesocial-iconshover codepenhover4
data-slice-typesocial-iconshover codepen4
data-slice-typesocial-iconshover pinteresthover4
data-slice-typesocial-iconshover behance4
data-slice-typesocial-iconshover bandsintownhover4
data-slice-typesocial-iconshover bandsintown4
data-slice-typesocial-iconshover applepodcasthover4
data-slice-typesocial-iconshover applepodcast4
audio-player-icons-style-solid data-slice-typealbumhover4
data-slice-typesocial-iconshover facebook4
data-slice-typealbumhover icon-wrapper4
data-slice-typealbumhover icon-wrapperhover4
data-slice-typetwitternotdata-compound-type tweet-body4
lock-style-border data-slice-typelock4
actionsnotstacked input-wrappernothidden4
data-slice-typebuttons lisqs-slide-wrapperdata-slide-typelock-screen4
buttonsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline4
svgsocial-webkit-transitionbackground-color 170ms4
data-compound-typepopup-overlay-action inputtypetextsqs-slide-wrapperdata-slide-typelock-screen4
data-compound-typepopup-overlay-action inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typelock-screen4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-compound-typepopup-overlay-action4
responsive-wrapperstacked sqs-slice-custom-form4
data-slice-typesocial-iconshover email4
data-slice-typesocial-iconshover behancehover4
data-slice-typesocial-iconshover facebookhover4
data-slice-typesocial-iconshover houzzhover4
data-slice-typesocial-iconshover pinterest4
data-slice-typesocial-iconshover meetuphover4
data-slice-typesocial-iconshover meetup4
data-slice-typesocial-iconshover mediumhover4
data-slice-typesocial-iconshover medium4
data-slice-typesocial-iconshover linkedinhover4
data-slice-typesocial-iconshover linkedin4
data-slice-typesocial-iconshover ituneshover4
data-slice-typesocial-iconshover itunes4
data-slice-typesocial-iconshover instagramhover4
data-slice-typesocial-iconshover instagram4
data-slice-typesocial-iconshover imdbhover4
data-slice-typesocial-iconshover imdb4
data-slice-typesocial-iconshover emailhover4
data-slice-typesocial-iconshover houzz4
data-slice-typesocial-iconshover goodreads4
data-slice-typesocial-iconshover github4
data-slice-typesocial-iconshover google4
data-slice-typesocial-iconshover foursquare4
data-slice-typesocial-iconshover githubhover4
data-slice-typesocial-iconshover flickrhover4
data-slice-typesocial-iconshover flickr4
data-slice-typesocial-iconshover fivehundredpixhover4
data-slice-typesocial-iconshover goodreadshover4
data-slice-typesocial-iconshover fivehundredpix4
data-slice-typesocial-iconshover googleplay4
data-slice-typesocial-iconshover googleplayhover4
data-slice-typesocial-iconshover foursquarehover4
social-icons-style-knockout data-slice-typesocial-icons3
data-slice-typesocial-icons svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typelock-screen3
li ahoversqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typesocial-icons use-maskfilltransparentsqs-slide-wrapperdata-slide-typelock-screen3
form-wrapper inputtypesubmithoversqs-slide-wrapperdata-slide-typelock-screen3
actionsstacked input-wrapper3
data-compound-typepopup-overlay-action error-messagesqs-slide-wrapperdata-slide-typelock-screen3
social-icons-style-solid data-slice-typesocial-icons3
inputtypetextsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
form-itemsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked input-wrapper3
importantsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em 5emfont14px3
sqs-slide-containerdata-slide-typepopup-overlay captcha-container-wrapper3
sqs-slice-custom-form ahoversqs-slide-wrapperdata-slide-typelock-screen3
lock-style-knockout data-slice-typelock3
data-slice-typelock use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typetwitternotdata-compound-type tweet-timestamp3
lock-style-solid data-slice-typelock3
sqs-slide-wrapperdata-slide-typelock-screen responsive-wrappernotstacked3
data-slice-typebuttons ahoversqs-slide-wrapperdata-slide-typelock-screen3
audio-player-icons-style-regular data-slice-typealbum3
sqs-slice-custom-form spansqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typebuttons ulstacked3
data-slice-typemap gmnoprint3
data-slice-typemap gm-style-cc3
only screen3
data-slice-typealbum sqs-slice-album-playliststacked3
data-slice-typealbum sqs-slice-album-playlistdemo-album3
data-slice-typealbum track-title3
data-slice-typegallery gallery-video-backgroundmobile3
data-slice-typetwitter tweet-avatar3
ease-intransitionopacity 2s3
2s ease-intransitionopacity3
ease-in-o-transitionopacity 2s3
2s ease-in-o-transitionopacity3
ease-in-ms-transitionopacity 2s3
2s ease-in-ms-transitionopacity3
ease-in-moz-transitionopacity 2s3
2s ease-in-moz-transitionopacity3
importantsqs-slide-wrapperdata-slide-typelock-screen sqs-slide-containernotauto-image-background-color3
data-compound-typepopup-overlay-action buttontypesubmitsqs-slide-wrapperdata-slide-typelock-screen3
asqs-slide-wrapperdata-slide-typelock-screen data-slice-typetwitter3
inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen button-style-outline3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-knockout3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto data-slice-typebuttons3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto data-slice-typebuttons3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline data-slice-typebuttons3
countdown-contentdata-formattextual countdown-unit3
sqs-slide-wrapperdata-slide-typelock-screen data-slice-typecountdown3
p ahoversqs-slide-wrapperdata-slide-typelock-screen3
p asqs-slide-wrapperdata-slide-typelock-screen3
ease-in-outsqs-slide-wrapperdata-slide-typelock-screen social-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-largesocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-solid3
data-slice-typepassword inputtypepasswordsqs-slide-wrapperdata-slide-typelock-screen3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-largesocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-mediumsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-smallsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typepassword arrow-icon3
2s easesqs-slide-wrapperdata-slide-typelock-screen3
actionsstacked input-wrappernothidden3
data-slice-typesocial-icons440
data-slice-typesocial-iconshover364
social-icons-color-standardsocial-icons-style-solid264
social-icons-color-standardsocial-icons-style-border176
use-iconfillfffsqs-slide-wrapperdata-slide-typelock-screen141
social-icons-color-standardsocial-icons-style-knockout132
social-icons-color-standardsocial-icons-style-regular132
data-slice-typealbum109
170ms90
data-compound-typepopup-overlay-action60
data-slice-typebuttons59
sqs-slide-containerdata-slide-typepopup-overlay55
icon-wrappersqs-slide-wrapperdata-slide-typelock-screen46
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typelock-screen44
2s41
asqs-slide-wrapperdata-slide-typelock-screen38
data-slice-typecountdown35
importantsqs-slide-wrapperdata-slide-typelock-screen34
data-slice-typegallery33
data-slice-typelock30
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline29
data-slice-typepassword29
form-wrapper28
sqs-album-minimal27
1s25
sqs-modal-lightbox-content24
0sqs-slide-wrapperdata-slide-typelock-screen24
sqs-slice-custom-form24
icon-wrapper23
use-iconfill222sqs-slide-wrapperdata-slide-typelock-screen23
ul22
lightbox-inner22
responsive-wrapperstacked21
data-slice-typebody21
sqs-slide-wrapperdata-slide-typelock-screen20
socialstacked20
020
socialstackedtext-align-left20
li20
button-style-outline19
lightbox-content19
countdown-contentdata-formatnumeric18
data-slice-typenavigation17
sqs-slice-album-playlist17
ease-in-outsqs-slide-wrapperdata-slide-typelock-screen17
tracks16
ease-in-out15
border-color15
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled15
all14
gallery-video-background14
p13
sqs-modal-lightbox-open13
ahoversqs-slide-wrapperdata-slide-typelock-screen13
social-icons-style-solid12
use-maskfill222sqs-slide-wrapperdata-slide-typelock-screen12
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typelock-screen12
0px12
icon-wrapperhover12
actionsnotstacked12
password-style-rectangle11
countdown-contentdata-formattextual11
password-style-underlined11
data-slice-typetwitter11
actionsstacked11
sqs-slice-play-buttonicon-wrappersqs-slide-wrapperdata-slide-typelock-screen10
max-width600pxsqs-slide-wrapperdata-slide-typelock-screen10
0ms10
email10
solid10
squarespace10
lisqs-slide-wrapperdata-slide-typelock-screen10
icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typelock-screen10
110
icon-wrapperlast-childsqs-slide-wrapperdata-slide-typelock-screen10
data-slice-typetwitternotdata-compound-type10
snapchat9
codepen9
rss9
behance9
smugmug9
bandsintown9
google9
applepodcast9
spotify9
stumbleupon9
thedots9
tidal9
tumblr9
twitch9
twitter9
soundcloud9
reddit9
dribbble9
foursquare9
imdb9
googleplay9
instagram9
goodreads9
itunes9
github9
linkedin9
flickr9
vimeo9
medium9
fivehundredpix9
meetup9
facebook9
pinterest9
rdio9
dropbox9
vevo9
stitcher9
houzz9
ease-in-outtransitionbackground-color9
ease-in-out-moz-transitionbackground-color9
ease-in-out-ms-transitionbackground-color9
ease-in-out-o-transitionbackground-color9
vine9
vsco9
youtube9
yelp9
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline8
use-backgroundfillfffsqs-slide-wrapperdata-slide-typelock-screen8
data-slice-typealbumhover8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-center8
sqs-slice-play-buttonicon-wrapper8
data-slice-typebodysqs-slide-wrapperdata-slide-typelock-screen7
input-wrappernothidden7
use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typelock-screen7
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen7
button-style-outlinesqs-modal-lightbox7
spansqs-slide-wrapperdata-slide-typelock-screen7
data-slice-typemap7
video-icon-style-border7
show-track-title7
inputtypetextsqs-slide-wrapperdata-slide-typelock-screen7
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked7
social-icons-style-border7
track7
audio-player-icons-style-solid6
10px6
social-icons-style-regular6
sqs-slice-play-buttonicon-wrapperhover6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typelock-screen6
ulsqs-slide-wrapperdata-slide-typelock-screen6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typelock-screen6
audio-player-icons-style-border6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-left6
button-style-raised6
input-wrapper6
inputtypesubmitsqs-slide-wrapperdata-slide-typelock-screen6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle6
2em6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline6
track-progress-bar6
instagramhover5
social-icons-style-knockout5
mediumhover5
twitterhover5
houzzhover5
use-maskfilltransparentsqs-slide-wrapperdata-slide-typelock-screen5
imdbhover5
linkedinhover5
vimeohover5
100ms5
vevohover5
meetuphover5
ituneshover5
ease-outopacity5
buttonsqs-slide-wrapperdata-slide-typelock-screen5
sqs-slide-layer-content5
twitchhover5
stitcherhover5
snapchathover5
soundcloudhover5
yelphover5
spotifyhover5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined5
01s5
squarespacehover5
smugmughover5
rsshover5
vinehover5
stumbleuponhover5
lock-style-regular5
vscohover5
reddithover5
thedotshover5
youtubehover5
tidalhover5
pinteresthover5
tumblrhover5
rdiohover5
flickrhover5
googlehover5
fivehundredpixhover5
button-shape-rounded-corners5
applepodcasthover5
bandsintownhover5
gmnoprint5
behancehover5
codepenhover5
gm-style-cc5
dribbblehover5
sqs-slice-album-playlistplaying5
dropboxhover5
6px5
emailhover5
tweet-timestamp5
facebookhover5
button-shape-pill5
foursquarehover5
googleplayhover5
goodreadshover5
svgsocial-webkit-transitionbackground-color5
audio-player-icons-style-regular5
githubhover5
tweet-body4
lock-style-border4
track-title4
use-iconfilltransparentsqs-slide-wrapperdata-slide-typelock-screen4
audio-player-icons-style-knockout4
video-icon-style-regular4
5px4
form-itemsqs-slide-wrapperdata-slide-typelock-screen4
icon-wrapperwidth24pxheight24pxmargin04
displaytablesqs-slide-wrapperdata-slide-typelock-screen4
autosqs-slide-wrapperdata-slide-typelock-screen4
map-style-minimal-dark4
ulstacked4
4px4
inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typelock-screen4
video-icon-style-solid4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-raised4
social-icons-size-extra-largesocial-icons-style-solid3
use-iconfille0393esqs-slide-wrapperdata-slide-typelock-screen3
lock-style-knockout3
icon-wrapperdiv-webkit-transformscale2-moz-transformscale2-ms-transformscale2transformscale2sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillf94877sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill0976b4sqs-slide-wrapperdata-slide-typelock-screen3
video-icon-style-knockout3
3px3
icon-wrapperwidth28pxheight28pxmargin03
use-iconfill0063dcsqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill00ab6csqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill0099e5sqs-slide-wrapperdata-slide-typelock-screen3
fffsqs-slide-wrapperdata-slide-typelock-screen3
icon-wrapperwidth32pxheight32pxmargin03
icon-wrapperwidth36pxheight36pxmargin03
lock-style-solid3
use-iconfill222background-color222sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill3b5998sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillcc2127sqs-slide-wrapperdata-slide-typelock-screen3
7px3
svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill007ee5sqs-slide-wrapperdata-slide-typelock-screen3
button-play-pause3
use-iconfill006ed2sqs-slide-wrapperdata-slide-typelock-screen3
inputtypesubmithoversqs-slide-wrapperdata-slide-typelock-screen3
sqs-slice-album-playlistdemo-album3
button-style-solid3
sqs-slice-album-playliststacked3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto3
use-iconfillec4652sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill4183c4sqs-slide-wrapperdata-slide-typelock-screen3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline3
error-messagesqs-slide-wrapperdata-slide-typelock-screen3
responsive-wrapper3
sqs-slicedata-content-emptytruedisplaynonesqs-slide-wrapperdata-slide-typelock-screen3
sqs-slide-containerdata-slide-typepopup-overlayenable-overlay-content-border3
actionssqs-slide-wrapperdata-slide-typelock-screen3
responsive-wrappernotstacked3
adisplayblocksqs-slide-wrapperdata-slide-typelock-screen3
sqs-slide-containerdata-slide-typepopup-overlayoverlay-load-animation-slide-in3
sqs-slidesqs-slide-animation-ready3
responsive-wrapperstackedtext-align-center3
autoflex13
use-iconfill7ac143sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill5adfcbsqs-slide-wrapperdata-slide-typelock-screen3
use-iconfille6b91esqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typebuttonssqs-slide-wrapperdata-slide-typelock-screen3
use-iconfille4405fsqs-slide-wrapperdata-slide-typelock-screen3
sqs-slice-custom-formsqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill382110sqs-slide-wrapperdata-slide-typelock-screen3
data-slice-typegallerysqs-gallery-grid3
sqs-slide-containernotauto-image-background-color3
ease-in-moz-transitionopacity3
5emfont14px3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em3
ease-in-ms-transitionopacity3
ease-in-o-transitionopacity3
ease-intransitionopacity3
captcha-container-wrapper3
sqs-slide-containerdata-slide-typepopup-overlaybutton-style-outline3
gallery-video-backgroundmobile3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto3
only3
social-icons-size-extra-largesocial-icons-style-knockout3
social-icons-size-extra-smallsocial-icons-style-solid3
social-icons-size-extra-smallsocial-icons-style-regular3
social-icons-size-smallsocial-icons-style-regular3
use-iconfillff0031sqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-mediumsocial-icons-style-regular3
social-icons-size-largesocial-icons-style-regular3
use-iconfill55aceesqs-slide-wrapperdata-slide-typelock-screen3
8px3
social-icons-size-extra-largesocial-icons-style-regular3
use-iconfill6441a5sqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-extra-smallsocial-icons-style-border3
social-icons-size-extra-smallsocial-icons-style-knockout3
use-iconfill35465dsqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-smallsocial-icons-style-border3
14px3
social-icons-size-smallsocial-icons-style-knockout3
social-icons-size-smallsocial-icons-style-solid3
use-iconfill8c8070sqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-mediumsocial-icons-style-border3
social-icons-size-mediumsocial-icons-style-knockout3
use-iconfilleb4924sqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-mediumsocial-icons-style-solid3
social-icons-size-largesocial-icons-style-border3
use-iconfill1ea9e1sqs-slide-wrapperdata-slide-typelock-screen3
social-icons-size-largesocial-icons-style-knockout3
social-icons-size-largesocial-icons-style-solid3
social-icons-size-extra-largesocial-icons-style-border3
use-iconfill84bd00sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill1ab7easqs-slide-wrapperdata-slide-typelock-screen3
arrow-icon3
ease-in-outtransitioncolor3
data-slice-typeheadingnotdata-compound-type3
ease-in-out-o-transitioncolor3
ease-in-out-ms-transitioncolor3
ease-in-out-moz-transitioncolor3
screen3
use-iconfillea4c89sqs-slide-wrapperdata-slide-typelock-screen3
countdown-unit3
use-iconfillff4500sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill1769ffsqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill7dbb00sqs-slide-wrapperdata-slide-typelock-screen3
disclaimer-containersqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill00b4b3sqs-slide-wrapperdata-slide-typelock-screen3
1px3
use-iconfill000sqs-slide-wrapperdata-slide-typelock-screen3
max-width1020pxsqs-slide-wrapperdata-slide-typelock-screen3
use-iconfill00b488sqs-slide-wrapperdata-slide-typelock-screen3
buttontypesubmitsqs-slide-wrapperdata-slide-typelock-screen3
icon-wrapperborder2px3
sqs-modal-lightbox3
use-iconfilldc4e41sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfille52d27sqs-slide-wrapperdata-slide-typelock-screen3
tweet-display-name3
tweet-handle3
use-iconfillc41200sqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillf60sqs-slide-wrapperdata-slide-typelock-screen3
avisitedsqs-slide-wrapperdata-slide-typelock-screen3
use-iconfillae995asqs-slide-wrapperdata-slide-typelock-screen3
inputtypepasswordsqs-slide-wrapperdata-slide-typelock-screen3
easesqs-slide-wrapperdata-slide-typelock-screen3
tweet-avatar3

Who hosts Conti-choc.club?

Conti-choc.club Hosting Provider Information

Hosted IP Address:198.185.159.145
Hosted Hostname:198.185.159.145
Service Provider:SQUARESPACE
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Squarespace

Is "SQUARESPACE" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
18.1104%
GOOGLE
13.7558%
AS-26496-GO-DADDY-COM-LLC
3.6367%
NAMECHEAP-NET
3.0541%
AMAZON-AES
2.2094%
GoDaddy.com, LLC
2.0363%
UNIFIEDLAYER-AS-1
1.9078%
Fara Negar Pardaz Khuzestan
1.5654%
CONFLUENCE-NETWORK-INC
1.4231%
1&1 Internet AG
1.3177%
SQUARESPACE
1.1103%

HTTP Header Analysis for Conti-choc.club

Http-Version: 1.1
Status-Code: 401
Status: 401 Unauthorized
Age: 0
Content-Type: text/html;charset=utf-8
Date: Sat, 08 May 2021 14:21:13 GMT
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Server: Squarespace
Strict-Transport-Security: max-age=43200
X-Content-Type-Options: nosniff
X-Contextid: oVwQPAXE/rb8T2cjw
Transfer-Encoding: chunked

Conti-choc.club Domain Nameserver Information

HostIP AddressCountry
dns4.p04.nsone.net 198.51.45.68
dns3.p04.nsone.net 198.51.44.68
dns2.p04.nsone.net 198.51.45.4
dns1.p04.nsone.net 198.51.44.4
ns04.squarespacedns.com 45.54.22.193
ns03.squarespacedns.com 45.54.22.129
ns02.squarespacedns.com 45.54.22.65
ns01.squarespacedns.com 45.54.22.1


Need to find out who hosts Conti-choc.club?


Domain Registration (WhoIs) information for Conti-choc.club

 Domain Name: conti-choc.club
Registry Domain ID: D9711ADC0AA2B4D619F068820293055D3-NSR
Registrar WHOIS Server: whois.opensrs.net
Registrar URL: www.opensrs.com
Updated Date: 2020-09-29T12:36:27Z
Creation Date: 2019-10-09T08:44:14Z
Registry Expiry Date: 2021-10-09T08:44:14Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4165350123
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: Contact Privacy Inc. Customer 0155915102
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: ON
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: CA
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: dns2.p04.nsone.net
Name Server: dns4.p04.nsone.net
Name Server: dns1.p04.nsone.net
Name Server: dns3.p04.nsone.net
Name Server: ns01.squarespacedns.com
Name Server: ns03.squarespacedns.com
Name Server: ns04.squarespacedns.com
Name Server: ns02.squarespacedns.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-05-08T14:21:16Z

Websites with Similar Names

Conti-abroad.com
conti-abroad.com - conti abroad Resources and Information.
Conti-assicurazioni.com
conti-assicurazioni.com
Conti-bau.com
Startseite
Conti-bg.com
Дрехи за бременни - Mama Conti Boutique
Conti-bicycletyres.com
Continental bicycle tyres
Conti-bike.co.uk
Bot Verification
Conti-central.co.uk
Site Not Configured | 404 Not Found
Conti-choc.club
Continental Chocolate Club ® — Secure

Recently Updated Websites

Ageofseadogs.com (3 seconds ago.)Yibobet1573.app (5 seconds ago.)H2cosmetics.com (6 seconds ago.)Goldfinancialmortgageservice.com (8 seconds ago.)Builderiq.net (8 seconds ago.)Sinterklaasfan.nl (8 seconds ago.)Naturallywithnadya.com (9 seconds ago.)Annebisone.com (9 seconds ago.)Colopiano.com (9 seconds ago.)Girlgimmiethat.com (11 seconds ago.)Cartvellas.com (12 seconds ago.)Joshsandersmusic.com (12 seconds ago.)Princeassistance.com (13 seconds ago.)Lgzrgc.top (14 seconds ago.)Veventaas.com (16 seconds ago.)Matineeminutiae.com (17 seconds ago.)Thebotanybay.net (18 seconds ago.)Bibelkreis.net (19 seconds ago.)Dawidmed.tech (19 seconds ago.)Therunningresident.com (19 seconds ago.)Mx52.com (20 seconds ago.)Hometesterclub.com (20 seconds ago.)Digiwebsolutions.net (21 seconds ago.)Poluohuang.net (21 seconds ago.)Quepasaoaxaca.com (21 seconds ago.)Budmannewportbeach.com (22 seconds ago.)911dryerventcleaningarlington.com (23 seconds ago.)Infantryjunkremoval.com (23 seconds ago.)Bahbu.com (24 seconds ago.)Sebeh.org (24 seconds ago.)

Recently Searched Keywords

kim ng (1 second ago.)smg packaging (1 second ago.)hero main-heading (1 second ago.)memoir 44 breakthrough (1 second ago.)лечение от соли (1 second ago.)1- else if (2 seconds ago.)price gold price (2 seconds ago.)dekker (2 seconds ago.)family photo books (2 seconds ago.)accredited online (3 seconds ago.)все разделы форума (3 seconds ago.)scxw158076496 stylebackground-color (3 seconds ago.)biro travel haji plus malang (3 seconds ago.)widget-2a350fd5ba004314a3d22de04fbca83b img-8492b326ed0d43feb0e44c3afeb5488f background-image (4 seconds ago.)2017 nbsp11 (4 seconds ago.)高手贴177期【澳门七尾】355151 (4 seconds ago.)move forward (4 seconds ago.)hoover dam bypass las vegas (5 seconds ago.)is your body trying to tell you something (5 seconds ago.)un negocio redondo (5 seconds ago.)衬胶管道的特性 (5 seconds ago.)www.stop-maux-de-dos.com (5 seconds ago.)herosubheadinginnerhtml move (5 seconds ago.)bengaline trousers meaning (6 seconds ago.)昆明分公司 (6 seconds ago.)tarahubbard (6 seconds ago.)21diamonds m (6 seconds ago.)россия61 (6 seconds ago.)azure pricing calculator (6 seconds ago.)自拍偷拍 (7 seconds ago.)