Coresafety.org Favicon Coresafety.org

Coresafety.org Website Thumbnail
Checking...
CORESafety
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
coresafety
Domain extension
org
Domain registered:
2011-03-08
Domain updated:
2020-09-08
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is coresafety.org ranked relative to other sites:

Percentage of visits to coresafety.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Coresafety.org registered?
A: Coresafety.org was registered 9 years, 6 months, 2 weeks, 5 days, 23 hours, 20 minutes, 22 seconds ago on Tuesday, March 8, 2011.
Q: When was the WHOIS for Coresafety.org last updated?
A: The WHOIS entry was last updated 2 weeks, 5 days, 23 hours, 20 minutes, 22 seconds ago on Tuesday, September 8, 2020.
Q: What are Coresafety.org's nameservers?
A: DNS for Coresafety.org is provided by the following nameservers:
  • ns33.domaincontrol.com
  • ns34.domaincontrol.com
Q: Who is the registrar for the Coresafety.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Coresafety.org?
A: Coresafety.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Coresafety.org each day?
A: Coresafety.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Coresafety.org resolve to?
A: Coresafety.org resolves to the IPv4 address 13.68.76.95.
Q: In what country are Coresafety.org servers located in?
A: Coresafety.org has servers located in the United States.
Q: What webserver software does Coresafety.org use?
A: Coresafety.org is powered by Apache/2.4.18 (Ubuntu) webserver.
Q: Who hosts Coresafety.org?
A: Coresafety.org is hosted by University of Central Florida in Virginia, Boydton, United States, 23917.
Q: How much is Coresafety.org worth?
A: Coresafety.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Coresafety.org?

Coresafety.org Hosting Provider Information

Hosted IP Address:13.68.76.95
Hosted Hostname:13.68.76.95
Service Provider:University of Central Florida
Hosted Country:United StatesUS
Location Latitude:36.6534
Location Longitude:-78.375
Webserver Software:Apache/2.4.18 (Ubuntu)

Is "University of Central Florida" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Coresafety.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 08 Sep 2020 17:07:43 GMT
Server: Apache/2.4.18 (Ubuntu)
Link:; rel="https://api.w.org/", ; rel=shortlink
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 9364
Content-Type: text/html; charset=UTF-8

Coresafety.org Domain Nameserver Information

HostIP AddressCountry
ns33.domaincontrol.com 97.74.106.17
ns34.domaincontrol.com 173.201.74.17


Need to find out who hosts Coresafety.org?


WhoIs information for Coresafety.org

 Domain Name: CORESAFETY.ORG
Registry Domain ID: D162945973-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2020-07-07T15:25:36Z
Creation Date: 2011-08-03T14:16:13Z
Registry Expiry Date: 2022-08-03T14:16:13Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: National Mining Association
Registrant State/Province: District of Columbia
Registrant Country: US
Name Server: NS33.DOMAINCONTROL.COM
Name Server: NS34.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-09-08T17:06:44Z

Coresafety.org Free SEO Report

Website Inpage Analysis for Coresafety.org

H1 Headings

0 :

H2 Headings

3 :
  1. Achieving a Core Value
  2. CORESafety Multimedia
  3. Safety Insights

H3 Headings

1 :
  1. CORESafety TV (September 2020): Improving Your Mine Traffic Flow Patterns Pt. 2

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

9 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-33705515-1

Links - Internal

26:
  1. No text
    https://www.coresafety.org
  2. Home
    https://www.coresafety.org/
  3. Why CORESafety
    https://www.coresafety.org/why-coresafety/safety-comes-first/
  4. Safety Comes First
    https://www.coresafety.org/why-coresafety/safety-comes-first/
  5. Safety is Good Business
    https://www.coresafety.org/why-coresafety/safety-is-also-good-business/
  6. Participating Companies
    https://www.coresafety.org/participating-companies/
  7. CORESafety Overview
    https://www.coresafety.org/core-safety-overview/
  8. CORESafety Framework
    https://www.coresafety.org/coresafety-framework/getting-started/
  9. Getting Started
    https://www.coresafety.org/coresafety-framework/getting-started/
  10. System
    https://www.coresafety.org/coresafety-framework/system/
  11. Handbook
    https://www.coresafety.org/coresafety-framework/handbook/
  12. Resources
    https://www.coresafety.org/coresafety-framework/resources/
  13. Blog
    https://www.coresafety.org/blog/
  14. Contact Us
    https://www.coresafety.org/contact/
  15. Learn More
    https://www.coresafety.org/safety-success-the-three-categories-of-learning/
  16. Safety Comes First
    http://www.coresafety.org/why-coresafety/safety-comes-first/
  17. Get Started With CORESafety
    http://www.coresafety.org/coresafety-framework/getting-started/
  18. Get Started
    http://www.coresafety.org/coresafety-framework/getting-started/
  19. Certified and Participating Companies
    https://www.coresafety.org/participating-companies/
  20. How to Lessen the Risks of Powered Haulage Collisions
    https://www.coresafety.org/wp-content/uploads/2019/06/Powered_Haulage_Collision_Prevention.pdf
  21. How to Be Safe on Ladders
    http://www.coresafety.org/wp-content/uploads/2019/04/coresafety_ladder_2019-pdf.pdf
  22. Five Safety Hazards to Anticipate and Handle with Technology
    https://coresafety.org/wp-content/uploads/2019/01/CORESafety_InfographicJanuary_13_2019_Five_Safety_Hazards_Technology_FINAL_Newbackground_.pdf
  23. View All Resources
    https://www.coresafety.org/safety-insights__trashed/blog/
  24. CORESafety TV (September 2020): Improving Your Mine Traffic Flow Patterns Pt. 2
    https://www.coresafety.org/coresafety-tv-september-2020-improving-your-mine-traffic-flow-patterns-pt-2/
  25. Read more
    https://www.coresafety.org/coresafety-tv-september-2020-improving-your-mine-traffic-flow-patterns-pt-2/
  26. Privacy Policy
    https://www.coresafety.org/privacy-policy/

Links - Internal (nofollow)

0:

Links - Outbound

6:
  1. Watch Now
    https://www.youtube.com/watch?v=TEFpVawbKEY
  2. View Here
    https://www.youtube.com/watch?v=dlHJM9LNkXc&t=2s
  3. Social media & sharing icons
    https://www.ultimatelysocial.com/?utm_source=usmi_settings_page&utm_campaign=credit_link_to_homepage&utm_medium=banner
  4. No text
    https://www.facebook.com/CORESafety.org/
  5. No text
    https://twitter.com/NMACORESafety
  6. No text
    https://www.youtube.com/user/nationalmining

Links - Outbound (nofollow)

0:

Keyword Cloud for Coresafety.org

fontfamily helveticaarialsansserifimportant textalign center10em marginbottom 05em14pxhelveticaarialsansserif importantwidthmarginbottomhealthstartedimportant fontstylefontfamilytruehelveticaarialsansserif important fontstylewereturnsfsisubscribepopinner1firstpaddingcoresafety tvifmargintopsafetyhelveticaarialsansserifimportant color importantwidth 100100 importantimportantimportant fontsize 14pxfontfamily helveticaarialsansserif importantimportant paddingmarginseptember 2020important sfsisubscribepopinnerfontstyleimportant colorfontstyle normal importantcolor importanttrafficfontweight bolddisplaytextalign center importantnonemargin 00center important14px important textalignmargintop 10em10emselsefunctionboldvarseptemberborderboxcenter important sfsisubscribepopinner2color important fontsizeimportant fontstyle normalnormaldocumentfontsizeminingtextalignmarginbottom 05emtextalign centerwidth 100 importantmargintop 10em marginbottomnormal important colorblockfontweightfontsize 14px importantfontstyle normaltvnameemailcolor14px important05emcoresafetyfontsize 14px10em marginbottomnormal importantcenterimportant textalignminedisplay blockimportant fontsize

Longtail Keyword Density for Coresafety.org

KeywordsOccurences
font-family helveticaarialsans-serif important7
important text-align center7
text-align center important7
helveticaarialsans-serif important font-style5
important font-style normal5
font-style normal important5
normal important color5
important color important5
color important font-size5
important font-size 14px5
font-size 14px important5
14px important text-align5
center important sfsisubscribepopinner5
margin-top 10em margin-bottom3
10em margin-bottom 05em3
width 100 important3
important sfsisubscribepopinner8
font-family helveticaarialsans-serif7
important color7
center important7
text-align center7
important text-align7
important font-size7
helveticaarialsans-serif important7
width 1006
font-size 14px5
color important5
normal important5
font-style normal5
important font-style5
14px important5
margin-top 10em4
margin-bottom 05em4
coresafety tv4
september 20203
important padding3
100 important3
margin 03
font-weight bold3
10em margin-bottom3
display block3
important48
var14
safety11
coresafety10
sfsisubscribepopinner9
font-size8
width8
margin-bottom8
08
font-family7
margin-top7
helveticaarialsans-serif7
color7
text-align7
center7
05em6
16
s5
email5
font-style5
normal5
14px5
display5
10em5
mining4
else4
tv4
margin4
padding4
we4
if4
24
mine4
first3
started3
september3
traffic3
health3
none3
true3
function3
border-box3
return3
name3
bold3
font-weight3
block3
document3

Coresafety.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Coresafety.org is a scam?

Websites with Similar Names

Cores-online.biz
cores-online.biz – このドメインはお名前.comで取得されています。
Cores.online
Domain im Kundenauftrag registriert
Cores4you.com
Foundry Sand Cores | Cores For You, Inc | United States
Coresafe.com
Coresafe - Workplace Health and Safety, Environmental
Coresafety.org
CORESafety

Recently Updated Websites

Lashnonsense.com 1 second ago.Atlantanewhomerebates.com 2 seconds ago.Csdydz.com 2 seconds ago.Xukachan.com 3 seconds ago.Terrazoom.com 3 seconds ago.Rockntape.com 3 seconds ago.Cocodrills.com 3 seconds ago.Campinteractive.org 3 seconds ago.Banamagroup.com 4 seconds ago.Sawdustandmuffins.com 4 seconds ago.Peacocksummer.clothing 4 seconds ago.Landselect.com 4 seconds ago.Barakef.com 5 seconds ago.Topvipescort.com 6 seconds ago.Fudandco.com 6 seconds ago.Restaurant-soulfood.com 6 seconds ago.Colinfox.com 6 seconds ago.Dhktcdabcd.com 6 seconds ago.Pharmacyhack.com 7 seconds ago.Studnieaquawiert.pl 7 seconds ago.Entertainmentvenues.com.au 7 seconds ago.Karlson-tourism.ru 7 seconds ago.Sierratraveler.com 8 seconds ago.Smile.org 8 seconds ago.Yxzshb.net 8 seconds ago.Nolico-taki.com 10 seconds ago.Hokhuatvietnam.org 10 seconds ago.Bootybabe.com 10 seconds ago.Jpn24.net 11 seconds ago.Incandescentbloom.com 11 seconds ago.