Cpam.org Favicon Cpam.org

Cpam.org Website Thumbnail
Checking...
Council of Presidential Awardees in Mathematics
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
cpam
Domain extension
org
Domain registered:
1997-12-16
Domain updated:
2020-08-31
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is cpam.org ranked relative to other sites:

Percentage of visits to cpam.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Cpam.org registered?
A: Cpam.org was registered 22 years, 9 months, 1 week, 5 days, 19 hours, 3 minutes, 8 seconds ago on Tuesday, December 16, 1997.
Q: When was the WHOIS for Cpam.org last updated?
A: The WHOIS entry was last updated 4 weeks, 19 hours, 3 minutes, 8 seconds ago on Monday, August 31, 2020.
Q: What are Cpam.org's nameservers?
A: DNS for Cpam.org is provided by the following nameservers:
  • ns1.netinteraction.com
  • ns2.netinteraction.com
Q: Who is the registrar for the Cpam.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Cpam.org?
A: Cpam.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Cpam.org each day?
A: Cpam.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Cpam.org resolve to?
A: Cpam.org resolves to the IPv4 address 23.253.239.253.
Q: In what country are Cpam.org servers located in?
A: Cpam.org has servers located in the United States.
Q: What webserver software does Cpam.org use?
A: Cpam.org is powered by Apache/2.4.33 (Ubuntu) webserver.
Q: Who hosts Cpam.org?
A: Cpam.org is hosted by Rackspace Hosting in Texas, San Antonio, United States, 78218.
Q: How much is Cpam.org worth?
A: Cpam.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Cpam.org?

Cpam.org Hosting Provider Information

Hosted IP Address:23.253.239.253
Hosted Hostname:apache5.netinteraction.com
Service Provider:Rackspace Hosting
Hosted Country:United StatesUS
Location Latitude:29.4963
Location Longitude:-98.4004
Webserver Software:Apache/2.4.33 (Ubuntu)

Is "Rackspace Hosting" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Cpam.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 31 Aug 2020 06:46:07 GMT
Server: Apache/2.4.33 (Ubuntu)
Last-Modified: Wed, 03 Jun 2020 06:19:21 GMT
ETag: "31c5-5a7280238a6f6-gzip"
Accept-Ranges: bytes
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 3220
Content-Type: text/html

Cpam.org Domain Nameserver Information

HostIP AddressCountry
ns1.netinteraction.com 50.56.224.150United States United States
ns2.netinteraction.com 50.56.246.216United States United States


Need to find out who hosts Cpam.org?


WhoIs information for Cpam.org

 Domain Name: CPAM.ORG
Registry Domain ID: D763402-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2018-01-15T19:34:59Z
Creation Date: 1997-12-16T05:00:00Z
Registry Expiry Date: 2025-12-15T05:00:00Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: ok https://icann.org/epp#ok
Registrant Organization: Council of Presidential Awardees in Mathematics
Registrant State/Province: DE
Registrant Country: US
Name Server: NS1.NETINTERACTION.COM
Name Server: NS2.NETINTERACTION.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-06-30T16:31:30Z

Cpam.org Free SEO Report

Website Inpage Analysis for Cpam.org

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

28 :
  1. Mission
  2. History
  3. Board
  4. Constitution
  5. Bylaws
  6. Benefits
  7. Payment Methods
  8. Donations
  9. Update Information
  10. Denise I. Griffiths CPAM Scholarship
  11. CPAM Student Achievement Award
  12. NCTM Annual Conference
  13. Leadership Seminar in Chicago
  14. Breakfast in Chicago
  15. Description of the Award
  16. Newest Awardees
  17. Application
  18. Math Websites
  19. IPAD Resources
  20. Elementary Links
  21. Middle School Links
  22. High School Links
  23. CPAM Authors - Publications
  24. LandsEnd Business Entire
  25. Bookmarkers
  26. News Alert - NCTM National Conference April 21-24, 2021Leadership Conference-April 21, 2021
  27. What is CPAM?
  28. Benefits of Being a CPAM Member

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

38:
  1. No text
    http://cpam.org/index.html
  2. Mission
    http://cpam.org/mission_Statement.html
  3. History
    http://cpam.org/background.html
  4. Board
    http://cpam.org/boardMembers.html
  5. Constitution
    http://cpam.org/Constitution.html
  6. Bylaws
    http://cpam.org/ByLaws.html
  7. Benefits
    http://cpam.org/CPAM_MembershipBenefits.html
  8. Payment Methods
    http://cpam.org/dues_page.html#paymentways
  9. Donations
    http://cpam.org/dues_page.html#donationscholarship
  10. Update Information
    http://cpam.org/MembershipForm.html
  11. Denise I. Griffiths CPAM Scholarship
    http://cpam.org/scholarshipinfo.html
  12. CPAM Student Achievement Award
    http://cpam.org/student_AchievementAward.html
  13. Leadership Seminar in Chicago
    http://cpam.org/seminar.html
  14. Breakfast in Chicago
    http://cpam.org/seminar.html
  15. Math Websites
    http://cpam.org/hotlink.html
  16. Elementary Links
    http://cpam.org/hotlink.html#elementary
  17. Middle School Links
    http://cpam.org/hotlink.html#middle
  18. High School Links
    http://cpam.org/hotlink.html
  19. CPAM Authors - Publications
    http://cpam.org/authorCorner.html
  20. LandsEnd Business Entire
    http://cpam.org/Cpam_logo_attire.html
  21. Bookmarkers
    http://cpam.org/bookmark.html
  22. Contacts
    http://cpam.org/boardMembers.html
  23. Leadership Conference-April 21, 2021
    http://cpam.org/seminar.html
  24. CPAM Constitution.
    http://cpam.org/Constitution.html
  25. CPAM Mission Statement.
    http://cpam.org/mission_Statement.html
  26. CPAM's history
    http://cpam.org/background.html
  27. Seminar and Breakfast
    http://cpam.org/seminar.html
  28. Click here
    http://cpam.org/MembershipForm.html
  29. CPAM Board Members
    http://cpam.org/boardMembers.html
  30. Background
    http://cpam.org/background.html
  31. BYLAWS
    http://cpam.org/ByLaws.html
  32. Board Members
    http://cpam.org/boardMembers.html
  33. Scholarship Info
    http://cpam.org/scholarshipinfo.html
  34. Author's Corner
    http://cpam.org/authorCorner.html
  35. Hot Links
    http://cpam.org/hotlink.html
  36. Membership Info
    http://cpam.org/dues_page.html
  37. Why become a member
    http://cpam.org/CPAM_MembershipBenefits.html
  38. NCTM Happenings: Seminar, Reception, and Breakfast
    http://cpam.org/seminar.html

Links - Internal (nofollow)

0:

Links - Outbound

9:
  1. NCTM Annual Conference
    http://www.nctm.org
  2. Presidential Awardee Info
    http://www.paemst.org
  3. Description of the Award
    https://www.paemst.org/
  4. Newest Awardees
    https://www.paemst.org/recognition
  5. Application
    https://s3.amazonaws.com/paemst.static/cportal/materials/outreach/2018-2019+Outreach+Brochure.pdf
  6. IPAD Resources
    http://mathipads.wikispaces.com/
  7. Presidential Award for Excellence in Mathematics Teaching
    http://www.paemst.org/
  8. NCTM
    http://www.nctm.org
  9. Teachers Development Group
    http://www.teachersdg.org

Links - Outbound (nofollow)

0:

Keyword Cloud for Cpam.org

boardconstitutionmissionpresidentialcouncilconferencebreakfastmembersawardmathematicsmemberbenefitscpamnctmawardeesseminarclicklinksresourcesachievementnationalinfostudentscholarship

Longtail Keyword Density for Cpam.org

KeywordsOccurences
cpam16
mathematics6
nctm5
presidential4
member4
scholarship4
links4
mission3
members3
council3
national3
resources3
awardees3
info3
seminar3
breakfast3
board3
conference3
award3
achievement3
student3
benefits3
constitution3
click3

Cpam.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Cpam.org is a scam?

Websites with Similar Names

Cpam-angouleme.fr
CPAM de la Charente
Cpam-bayonne.fr
Document sans nom
Cpam-yvelines.fr
403 Forbidden
Cpam.fr
cpam.fr
Cpam.org
Council of Presidential Awardees in Mathematics
Cpam.us
#1 Cash Getting Method
Cpam1410.com
CPAM1410 – La radio ethnique de langue française en Amérique du Nord
Cpamacao.com
Luiz F. Da Silva Pedruco | CPA | Auditor | Taxation Accountant Expert

Recently Updated Websites

Rlpoanepa.com 2 seconds ago.Stanmoreweb.com 2 seconds ago.Shanedoesvo.com 3 seconds ago.Jgrahamhair.com 3 seconds ago.Alifedecision.com 3 seconds ago.Thebubbleroom.com 4 seconds ago.Berniebaxter.com 4 seconds ago.Arbtech.co.uk 4 seconds ago.Clarifyall.com 5 seconds ago.Thejavajointonlakebonham.com 5 seconds ago.Garciasgrillandcantina.com 5 seconds ago.Autismtreatmentclinics.com 5 seconds ago.Tilecleaningwestminster.com 6 seconds ago.82xp.com 6 seconds ago.Danielmonaco.com 6 seconds ago.Zodml.org 6 seconds ago.Myzikakit.com 7 seconds ago.Ayingers.de 7 seconds ago.Jkdva1.com 8 seconds ago.Journeywaterfilter.com 8 seconds ago.Imbachs.com 8 seconds ago.Sicilytaste.com 9 seconds ago.Customfloorvents.com 9 seconds ago.Tidings.online 10 seconds ago.Valdesefirstbaptist.org 10 seconds ago.Castlewholesalers.com 10 seconds ago.Impgouv.com 11 seconds ago.Langandschwander.com 11 seconds ago.Thoughtbalz.com 12 seconds ago.Miamibreaker.com 12 seconds ago.