Crew-portland.org

Website Thumbnail
Checking...
Women in Commercial Real Estate | CREW Portland OR

Safety: Low trust score
Year Founded: 2001
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-25
Category: This site has not been categorized yet

CREW Portland, established in 1992 as Women in Commercial Real Estate currently has 160 members from entrepreneurs to executives from national companies.


Domain summary

Domain label
crew-portland
Domain extension
org
Domain registered:
2001-05-22
Domain updated:
2020-10-25
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is crew-portland.org ranked relative to other sites:

Percentage of visits to crew-portland.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Crew-portland.org registered?
A: Crew-portland.org was registered 19 years, 6 months, 6 days, 19 hours, 22 minutes, 37 seconds ago on Tuesday, May 22, 2001.
Q: When was the WHOIS for Crew-portland.org last updated?
A: The WHOIS entry was last updated 1 month, 3 days, 19 hours, 22 minutes, 37 seconds ago on Sunday, October 25, 2020.
Q: What are Crew-portland.org's nameservers?
A: DNS for Crew-portland.org is provided by the following nameservers:
  • ns.rackspace.com
  • ns2.rackspace.com
Q: Who is the registrar for the Crew-portland.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Crew-portland.org?
A: Crew-portland.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Crew-portland.org each day?
A: Crew-portland.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Crew-portland.org resolve to?
A: Crew-portland.org resolves to the IPv4 address 104.196.244.237.
Q: In what country are Crew-portland.org servers located in?
A: Crew-portland.org has servers located in the United States.
Q: What webserver software does Crew-portland.org use?
A: Crew-portland.org is powered by Nginx webserver.
Q: Who hosts Crew-portland.org?
A: Crew-portland.org is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Crew-portland.org worth?
A: Crew-portland.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Crew-portland.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Crew-portland.org Free SEO Report

Website Inpage Analysis for Crew-portland.org

H1 Headings

5 :
  1. Coming Up See Full Calendar
  2. Noteworthy See All News
  3. Platinum Sponsors See All Sponsors
  4. Gold Sponsors See All Sponsors
  5. Silver Sponsors See All Sponsors

H2 Headings

3 :
  1. Stoller Family Estate | Gold Sponsor
  2. Glumac – A Tetra Tech Company | Gold Sponsor
  3. Women in Construction – CREW Member Kathleen Buono’s Story

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

23 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-133160546-1

Links - Internal

31:
  1. https://www.crew-portland.org
    https://www.crew-portland.org
  2. Crew-portland Join Now
    https://www.crew-portland.org/join-now
  3. Crew-portland About
    https://www.crew-portland.org/about/
  4. Crew-portland Board of Directors
    https://www.crew-portland.org/board-of-directors/
  5. Crew-portland Diversity, Equity, and Inclusion Resources
    https://www.crew-portland.org/about/diversity-equity-and-inclusion-resources/
  6. Crew-portland Member Directory
    https://www.crew-portland.org/member-directory/
  7. Crew-portland News
    https://www.crew-portland.org/news/
  8. Crew-portland Calendar
    https://www.crew-portland.org/calendar/
  9. Crew-portland Committees
    https://www.crew-portland.org/committees/
  10. Crew-portland Sponsorship
    https://www.crew-portland.org/sponsorship/
  11. Crew-portland Membership
    https://www.crew-portland.org/membership/
  12. Crew-portland Member Spotlight
    https://www.crew-portland.org/member-spotlight/
  13. Crew-portland Awards
    https://www.crew-portland.org/awards/
  14. Crew-portland Contact
    https://www.crew-portland.org/contact/
  15. Crew-portland See Full Calendar
    http://crew-portland.org/calendar
  16. https://www.crew-portland.org/events/crew-sips-2/
    https://www.crew-portland.org/events/crew-sips-2/
  17. https://www.crew-portland.org/events/lunch-program-9/
    https://www.crew-portland.org/events/lunch-program-9/
  18. https://www.crew-portland.org/events/december-luncheon/
    https://www.crew-portland.org/events/december-luncheon/
  19. Crew-portland See All News
    http://crew-portland.org/news
  20. https://www.crew-portland.org/stoller-family-estate-gold-sponsor/
    https://www.crew-portland.org/stoller-family-estate-gold-sponsor/
  21. Crew-portland Stoller Family Estate | Gold Sponsor
    https://www.crew-portland.org/stoller-family-estate-gold-sponsor/
  22. Crew-portland Read More
    https://www.crew-portland.org/stoller-family-estate-gold-sponsor/
  23. https://www.crew-portland.org/glumac-a-tetra-tech-company-gold-sponsor/
    https://www.crew-portland.org/glumac-a-tetra-tech-company-gold-sponsor/
  24. Crew-portland Glumac – A Tetra Tech Company | Gold Sponsor
    https://www.crew-portland.org/glumac-a-tetra-tech-company-gold-sponsor/
  25. Crew-portland Read More
    https://www.crew-portland.org/glumac-a-tetra-tech-company-gold-sponsor/
  26. https://www.crew-portland.org/women-in-construction-crew-member-kathleen-buonos-story/
    https://www.crew-portland.org/women-in-construction-crew-member-kathleen-buonos-story/
  27. Crew-portland Women in Construction – CREW Member Kathleen Buono’s Story
    https://www.crew-portland.org/women-in-construction-crew-member-kathleen-buonos-story/
  28. Crew-portland Read More
    https://www.crew-portland.org/women-in-construction-crew-member-kathleen-buonos-story/
  29. http://crew-portland.org/sponsorship/
    http://crew-portland.org/sponsorship/
  30. http://crew-portland.org/membership/
    http://crew-portland.org/membership/
  31. Crew-portland See All Sponsors
    http://crew-portland.org/sponsorship/

Links - Internal (nofollow)

0:

Links - Outbound

6:

Links - Outbound (nofollow)

0:

Keyword Cloud for Crew-portland.org

giftnwtype event namefindevent nameinclusionfullertonhttpschemaorg typenetworkyourall sponsorstypecommerciallinkerrhtmldivcsswetype eventnavigationcontext httpschemaorgyouglumacprogramread morecalendargoldhtmldivinnerhtmlreadnewsoutsustainablehttpschemaorg type eventcontext httpschemaorg typeconstructionmembermorefullerton winessee allnameengineeringmembershipestatelunch programseecontexterr errhttpschemaorgtruesipssips membersponsors seesee all sponsorscanreal estatelunchcrew sipsbuildingallsponsors see allstartdatesponsorshipwinesrealimageeventenddatecrewvarkathleensponsors

Who hosts Crew-portland.org?

Crew-portland.org Hosting Provider Information

Hosted IP Address:104.196.244.237
Hosted Hostname:237.244.196.104.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:nginx

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%

HTTP Header Analysis for Crew-portland.org

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx
Date: Sun, 25 Oct 2020 11:35:39 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
Keep-Alive: timeout=20
Location: https://www.crew-portland.org/

Crew-portland.org Domain Nameserver Information

HostIP AddressCountry
ns.rackspace.com 69.20.95.4
ns2.rackspace.com 65.61.188.4


Need to find out who hosts Crew-portland.org?


Domain Registration (WhoIs) information for Crew-portland.org

 Domain Name: CREW-PORTLAND.ORG
Registry Domain ID: D71199219-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2020-03-22T06:53:53Z
Creation Date: 2001-05-22T00:03:37Z
Registry Expiry Date: 2021-05-22T00:03:37Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: CREW Portland
Registrant State/Province: OR
Registrant Country: US
Name Server: NS2.RACKSPACE.COM
Name Server: NS.RACKSPACE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-10-25T11:34:40Z

Websites with Similar Names

Crew-advisor.com
Welcome crew-advisor.com - Justhost.com
Crew-agency.co.uk
CREW AGENCY: MEDIA ADVERTISING, DIGITAL, VIDEO, COPYWRITING
Crew-agents.com
Wir arbeiten gerade an unserer Website
Crew-australia.org
Compliance and Risk Executive Women
Crew-boat.com
Hosted By One.com | Webhosting made simple
Crew-center.com
Your Cruise Ship News Information Station | Crew Center
Crew-centre.com
Loading...

Recently Updated Websites

Missetiquette.com 5 seconds ago.Dermarollerqmd.com 6 seconds ago.Dpshowrah.in 7 seconds ago.Tecnogers.com 9 seconds ago.Lanyingxiang.com 10 seconds ago.Bunantosou.com 11 seconds ago.Zinen-deli.com 13 seconds ago.Spacesheep.ph 13 seconds ago.Abfabfurniture.com 14 seconds ago.Spbinteres.ru 15 seconds ago.Bagthatcash.com 15 seconds ago.Lfywg.com 16 seconds ago.Kfo-anwalt.de 16 seconds ago.Growthtech.io 17 seconds ago.3xlburger.com 18 seconds ago.Bfs.it 19 seconds ago.Loogchoob.com 20 seconds ago.Excusethemess.co 20 seconds ago.Spicenflavors.com 21 seconds ago.Jope.co 23 seconds ago.Foodaholicart.com 23 seconds ago.Naturalpharm.net 24 seconds ago.Beautybiocosmeticshop.it 24 seconds ago.Newpathpsychological.com 25 seconds ago.Agrinegocio.net 25 seconds ago.Shinyoungmin.com 26 seconds ago.Headcoachsports.com 27 seconds ago.Rrandco.com 27 seconds ago.Mbagency.fr 32 seconds ago.Cosmeticascience.com 34 seconds ago.