Crystalhub.ru Favicon Crystalhub.ru

Crystalhub.ru Website Thumbnail
Checking...
Crystals from Swarovski
Low trust score
Add a review Change category Claim this site
Swarovski embellished ✓ Jewelry ✓ Apparel ✓ Shoes ✓ Bags ✓ Accessories. Discover products with Crystals from Swarovski


Domain summary

Domain label
crystalhub
Domain extension
ru
Domain registered:
2016-06-06
Domain updated:
2020-10-01
Domain expires:
2021-06-06
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is crystalhub.ru ranked relative to other sites:

Percentage of visits to crystalhub.ru from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Crystalhub.ru registered?
A: Crystalhub.ru was registered 4 years, 4 months, 2 weeks, 5 days, 14 hours, 26 minutes, 24 seconds ago on Monday, June 6, 2016.
Q: When was the WHOIS for Crystalhub.ru last updated?
A: The WHOIS entry was last updated 3 weeks, 3 days, 14 hours, 26 minutes, 24 seconds ago on Thursday, October 1, 2020.
Q: What are Crystalhub.ru's nameservers?
A: DNS for Crystalhub.ru is provided by the following nameservers:
  • ns17.knipp.net
  • ns2.knipp.de
  • ns3.knipp.de
Q: Who is the registrar for the Crystalhub.ru domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for Crystalhub.ru?
A: Crystalhub.ru has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Crystalhub.ru each day?
A: Crystalhub.ru receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Crystalhub.ru resolve to?
A: Crystalhub.ru resolves to the IPv4 address 195.253.6.126.
Q: In what country are Crystalhub.ru servers located in?
A: Crystalhub.ru has servers located in the Germany.
Q: What webserver software does Crystalhub.ru use?
A: Crystalhub.ru is powered by Apache webserver.
Q: Who hosts Crystalhub.ru?
A: Crystalhub.ru is hosted by Knipp Medien und Kommunikation GmbH in Germany.
Q: How much is Crystalhub.ru worth?
A: Crystalhub.ru has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Crystalhub.ru?

Crystalhub.ru Hosting Provider Information

Hosted IP Address:195.253.6.126
Hosted Hostname:webredir.knipp.de
Service Provider:Knipp Medien und Kommunikation GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Apache

Is "Knipp Medien und Kommunikation GmbH" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Crystalhub.ru

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Apache
Last-Modified: Wed, 30 Sep 2020 14:24:35 GMT
ETag: "23d30-5b088a8a82446-gzip"
Accept-Ranges: bytes
Content-Encoding: gzip
Content-Length: 35575
Content-Type: text/html; charset=UTF-8
Expires: Thu, 01 Oct 2020 01:41:21 GMT
Cache-Control: max-age=0, no-cache, no-store
Pragma: no-cache
Date: Thu, 01 Oct 2020 01:41:21 GMT
Connection: keep-alive
Vary: Accept-Encoding

Crystalhub.ru Domain Nameserver Information

HostIP AddressCountry
ns17.knipp.net 195.253.51.61
ns2.knipp.de 195.253.6.52
ns3.knipp.de 194.64.105.66


Need to find out who hosts Crystalhub.ru?


WhoIs information for Crystalhub.ru

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: CRYSTALHUB.RU
nserver: ns17.knipp.net.
nserver: ns2.knipp.de.
nserver: ns3.knipp.de.
state: REGISTERED, DELEGATED, VERIFIED
org: Swarovski AG
registrar: RU-CENTER-RU
admin-contact: https://www.nic.ru/whois
created: 2016-06-06T14:31:38Z
paid-till: 2021-06-06T14:31:38Z
free-date: 2021-07-07
source: TCI

Last updated on 2020-08-30T05:31:30Z

Crystalhub.ru Free SEO Report

Website Inpage Analysis for Crystalhub.ru

H1 Headings

3 :
  1. Crystals from Swarovski
  2. Latest Posts
  3. We love to share

H2 Headings

1 :
  1. Home

H3 Headings

15 :
  1. Huawei Limited Edition
  2. Rita in Palma
  3. Royal Warrant
  4. IamRetro’s Latest Limited–Edition Figures
  5. VERIFY THE AUTHENTICITY OF YOUR CODE
  6. Todo Mi Gusto
  7. Yuya Cosmetics
  8. Swarovski And Adidas Join Forces To Add Sparkle To Iconic Sneakers
  9. Eyewear From Blumarine By De Rigo Vision Is Both Feminine And Sophisticated
  10. Baroqco Brings Artistry To Jewelry With Its Brilliant New Collection
  11. Gina Never Disappoints With Its Swarovski Crystal–Embellished Shoes
  12. Newsletter
  13. Archive
  14. Community
  15. Follow us

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

22 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

72:
  1. Swarovski Shop for Professionals
    https://www.swarovski-professional.com/
  2. Swarovski Shop
    https://www.swarovski.com/
  3. No text
    https://www.crystals-from-swarovski.com/
  4. Crystals from Swarovski
    https://www.crystals-from-swarovski.com/
  5. Swarovski Seal
    https://seal.crystals-from-swarovski.com/
  6. Brands
    https://www.crystals-from-swarovski.com/brands/
  7. 简体中文
    https://www.crystals-from-swarovski.com/zh-hans/
  8. Français
    https://www.crystals-from-swarovski.com/fr/
  9. Italiano
    https://www.crystals-from-swarovski.com/it/
  10. Português
    https://www.crystals-from-swarovski.com/pt-br/
  11. Español
    https://www.crystals-from-swarovski.com/es/
  12. 日本語
    https://www.crystals-from-swarovski.com/ja/
  13. 한국어
    https://www.crystals-from-swarovski.com/ko/
  14. Trends
    https://www.crystals-from-swarovski.com/category/trends/
  15. Events
    https://www.crystals-from-swarovski.com/category/events/
  16. Interviews
    https://www.crystals-from-swarovski.com/category/interviews/
  17. Lifestyle
    https://www.crystals-from-swarovski.com/category/lifestyle/
  18. Highlights
    https://www.crystals-from-swarovski.com/category/highlights/
  19. No text
    https://www.crystals-from-swarovski.com/trends/swarovski-and-adidas-join-forces-to-add-sparkle-to-iconic-sneakers/
  20. No text
    https://www.crystals-from-swarovski.com/trends/love-in-a-bottle/
  21. No text
    https://www.crystals-from-swarovski.com/trends/jet-black-elegance/
  22. No text
    https://www.crystals-from-swarovski.com/highlights/huawei-launches-limited-edition-case-with-swarovski-crystals-in-pink-sakura/
  23. No text
    https://www.crystals-from-swarovski.com/highlights/rita-in-palma-combines-crochet-with-crystals-to-create-stunning-jewelry/
  24. No text
    https://www.crystals-from-swarovski.com/highlights/royal-warrant/
  25. No text
    https://www.crystals-from-swarovski.com/trends/iamretros-latest-limited-edition-figures-combine-swarovski-crystals-with-art-world-icons/
  26. No text
    https://seal.crystals-from-swarovski.com/
  27. No text
    https://www.crystals-from-swarovski.com/trends/todo-mi-gusto-features-swarovski-crystals-in-its-jewelry-collections/
  28. No text
    https://www.crystals-from-swarovski.com/highlights/yuya-cosmetics-releases-special-crystal-encrusted-gift-box/
  29. Swarovski And Adidas Join Forces To Add Sparkle To Iconic Sneakers
    https://www.crystals-from-swarovski.com/trends/swarovski-and-adidas-join-forces-to-add-sparkle-to-iconic-sneakers/
  30. Crystals from Swarovski
    https://www.crystals-from-swarovski.com/author/crystals-from-swarovski/
  31. Four iconic adidas Originals sneakers have been embellished with sparkling Swarovski crystalsThe year 2020 marks an anniversary year for both … Continue reading “Swarovski And Adidas Join Forces To Add Sparkle To Iconic Sneakers”
    https://www.crystals-from-swarovski.com/trends/swarovski-and-adidas-join-forces-to-add-sparkle-to-iconic-sneakers/
  32. Continue reading “Swarovski And Adidas Join Forces To Add Sparkle To Iconic Sneakers”
    https://www.crystals-from-swarovski.com/trends/swarovski-and-adidas-join-forces-to-add-sparkle-to-iconic-sneakers/
  33. No text
    https://www.crystals-from-swarovski.com/highlights/eyewear-from-blumarine-by-de-rigo-vision-is-both-feminine-and-sophisticated/
  34. Eyewear From Blumarine By De Rigo Vision Is Both Feminine And Sophisticated
    https://www.crystals-from-swarovski.com/highlights/eyewear-from-blumarine-by-de-rigo-vision-is-both-feminine-and-sophisticated/
  35. Dainty Swarovski crystals highlight the vintage inspiration behind these sunglassesSince 1977, Blumarine has been the go-to Italian brand for femininity … Continue reading “Eyewear From Blumarine By De Rigo Vision Is Both Feminine And Sophisticated”
    https://www.crystals-from-swarovski.com/highlights/eyewear-from-blumarine-by-de-rigo-vision-is-both-feminine-and-sophisticated/
  36. Continue reading “Eyewear From Blumarine By De Rigo Vision Is Both Feminine And Sophisticated”
    https://www.crystals-from-swarovski.com/highlights/eyewear-from-blumarine-by-de-rigo-vision-is-both-feminine-and-sophisticated/
  37. No text
    https://www.crystals-from-swarovski.com/highlights/baroqco-brings-artistry-to-jewelry-with-its-brilliant-new-collection/
  38. Baroqco Brings Artistry To Jewelry With Its Brilliant New Collection
    https://www.crystals-from-swarovski.com/highlights/baroqco-brings-artistry-to-jewelry-with-its-brilliant-new-collection/
  39. Dutch brand BAROQCO designs one-of-a-kind jewelry that sparkles – and turns heads.A firm favourite on the red carpet and Paris … Continue reading “Baroqco Brings Artistry To Jewelry With Its Brilliant New Collection”
    https://www.crystals-from-swarovski.com/highlights/baroqco-brings-artistry-to-jewelry-with-its-brilliant-new-collection/
  40. Continue reading “Baroqco Brings Artistry To Jewelry With Its Brilliant New Collection”
    https://www.crystals-from-swarovski.com/highlights/baroqco-brings-artistry-to-jewelry-with-its-brilliant-new-collection/
  41. No text
    https://www.crystals-from-swarovski.com/trends/gina-never-disappoints-with-its-swarovski-crystal-embellished-shoes/
  42. Gina Never Disappoints With Its Swarovski Crystal–Embellished Shoes
    https://www.crystals-from-swarovski.com/trends/gina-never-disappoints-with-its-swarovski-crystal-embellished-shoes/
  43. London brand GINA continues its legacy of creating luxury handmade shoes that sparkleFounded in 1954 by master shoemaker Mehmet Kurdash, … Continue reading “Gina Never Disappoints With Its Swarovski Crystal–Embellished Shoes”
    https://www.crystals-from-swarovski.com/trends/gina-never-disappoints-with-its-swarovski-crystal-embellished-shoes/
  44. Continue reading “Gina Never Disappoints With Its Swarovski Crystal–Embellished Shoes”
    https://www.crystals-from-swarovski.com/trends/gina-never-disappoints-with-its-swarovski-crystal-embellished-shoes/
  45. Whether your design DNA is classic, otherworldly,
    https://www.instagram.com/p/CFuj0FwBnaR/
  46. Introducing a new family of crystals that represen
    https://www.instagram.com/p/CFujtT_BZTN/
  47. A shining example of conscious elegance, this Rosa
    https://www.instagram.com/p/CFujm5KBZRu/
  48. Introducing our brilliant Crystal Fine Rock links.
    https://www.instagram.com/p/CFq4hPqIxil/
  49. How will you create everyday sparkle? Be it tactil
    https://www.instagram.com/p/CFq4Lt3I_BL/
  50. The devil is in the detail with this intricate bou
    https://www.instagram.com/p/CFq3_X9oArx/
  51. Follow on Instagram
    https://www.instagram.com/swarovskiforprofessionals/
  52. September 2020
    https://www.crystals-from-swarovski.com/2020/09/
  53. August 2020
    https://www.crystals-from-swarovski.com/2020/08/
  54. July 2020
    https://www.crystals-from-swarovski.com/2020/07/
  55. June 2020
    https://www.crystals-from-swarovski.com/2020/06/
  56. May 2020
    https://www.crystals-from-swarovski.com/2020/05/
  57. April 2020
    https://www.crystals-from-swarovski.com/2020/04/
  58. March 2020
    https://www.crystals-from-swarovski.com/2020/03/
  59. Editorial Team
    https://www.crystals-from-swarovski.com/editorial-team
  60. Guest Contributors
    https://www.crystals-from-swarovski.com/guest-contributors
  61. facebook
    https://www.facebook.com/swarovskiforprofessionals
  62. instagram
    https://www.instagram.com/swarovskiforprofessionals
  63. twitter
    https://twitter.com/swarovski
  64. youtube
    https://www.youtube.com/playlist?list=PLD5730189D9597E0C
  65. pinterest
    https://www.pinterest.com/swarovski/collaborations-that-sparkle
  66. For brand owners
    https://www.swarovski-professional.com/
  67. World of Swarovski
    https://www.swarovskigroup.com/S/home/index.en.html
  68. NEWSLETTER
    https://www.crystals-from-swarovski.com/newsletter/
  69. Condition of use
    https://www.crystals-from-swarovski.com/conditions-of-use/
  70. DATA PROTECTION
    https://www.crystals-from-swarovski.com/data-protection/
  71. IMPRINT
    https://www.crystals-from-swarovski.com/imprint/
  72. English
    https://www.crystals-from-swarovski.com/

Links - Outbound (nofollow)

0:

Keyword Cloud for Crystalhub.ru

brandpgw5f733abcc7c7b1plw5f733abcc7c7bsparkleposted13 middotbrilliantcpgw5f733abcc7c7b0forcescontinue readingyoureading2020septembercrystalsitsmiddotjewelryjoin forcesfunctionpgw5f733b729f3151hellip continue readingadidas joinhellippanelgrid0pxusepanelw5f733b729f3151000px 0px 0px113 middot 2020we0px 0pxhellip continuepgw5f733b729f3150posted on september0searchcontinuepanelwidgetstyleblumarineseptembermiddot 2020crystals from swarovskibothmiddot 2020septemberdocumentbodyclassnamenewadidaspanelgridcellvarjoinpanelrowstyle panelgridcelladidas join forcespanelrowstylemarginbottom0pxplw5f733b729f315swarovskiiconic

Longtail Keyword Density for Crystalhub.ru

KeywordsOccurences
crystals from swarovski5
posted on september4
hellip continue reading4
adidas join forces3
13 middot 20203
0px 0px 0px3
panel-row-style panel-grid-cell6
0px 0px6
middot 20204
hellip continue4
continue reading4
adidas join3
join forces3
middot 2020september3
13 middot3
swarovski16
panel-grid-cell14
panel-row-style12
012
pl-w5f733b729f3159
0px9
pl-w5f733abcc7c7b8
middot7
crystals7
var6
september5
its5
continue5
we4
margin-bottom0px4
you4
brand4
hellip4
reading4
panel-grid4
posted4
adidas4
search4
panel-widget-style3
pg-w5f733abcc7c7b-03
pg-w5f733abcc7c7b-13
c3
panel-w5f733b729f315-1-0-03
pg-w5f733b729f315-13
brilliant3
pg-w5f733b729f315-03
function3
use3
new3
jewelry3
blumarine3
13
both3
iconic3
sparkle3
2020september3
forces3
join3
documentbodyclassname3

Crystalhub.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Crystalhub.ru is a scam?

Websites with Similar Names

Cryst.ru
[.m] masterhost - профессиональный хостинг сайтаcryst.ru
Crysta-kikaku.net
403 error - Forbidden
Crysta.co
治療室クリスタ|東京日本橋三越前の鍼灸院です
Crystacode.com
CrystaCode Inc.
Crystae.net
hello world | Tom Jakubowski
Crystagen.com
crystagen.com - Registered at Namecheap.com
Crystaghs.xyz
crystaghs.xyz - Registered at Namecheap.com

Recently Updated Websites

Cnvill.net 2 seconds ago.Dvvent.com 2 seconds ago.Thehumanityexperience.org 3 seconds ago.Thepinkfrost.com 3 seconds ago.Catherinecorrige.com 3 seconds ago.Belleville-store.de 3 seconds ago.Aussiesindemand.com 3 seconds ago.Zfmy999.com 4 seconds ago.Nypetals.com 4 seconds ago.Kmzx.org 4 seconds ago.Golfzeneiopenmasters.net 5 seconds ago.Luxlightingdesigninc.com 6 seconds ago.Arbaa7.com 6 seconds ago.Voly.org 6 seconds ago.Hsvvisitormap.com 7 seconds ago.Pornimdb.com 8 seconds ago.Officinalvitiroosms.com 8 seconds ago.Ringtone1.info 8 seconds ago.Playmodels.info 8 seconds ago.Stemsummitseries.net 8 seconds ago.Mancuakimxuan.com 8 seconds ago.Barbiebasics.com 8 seconds ago.Hemingwayapp.com 8 seconds ago.Oasisbanquetinguk.com 9 seconds ago.Touchthefuture.us 9 seconds ago.Logitechmarket.com.ua 10 seconds ago.Tecumsehherald.com 10 seconds ago.Szwlwl.cn 10 seconds ago.Noi-japan.com 10 seconds ago.Borsone.com 11 seconds ago.