Shop The World's Best Beauty Buys | Cult Beauty

THE destination for the very best in beauty, we trawl the globe to create a curated ‘Hall of Fame’. From bestselling skin care to make up must-haves, take advantage of FREE WORLDWIDE SHIPPING when you spend £40.


Domain summary

SafetyLow trust score
Year Founded
07
Global Traffic Rank
22,291
Estimated Worth
$681,840
Last updated
2021-10-23
Domain label
cultbeauty
Domain extension
co.uk
Domain registered:
07-Feb-2005
Domain updated:
17-Sep-2021
Statvoo Rating
C
Estimated daily income
$947
Estimated monthly income
$28,805

Frequently Asked Questions (FAQ)

Q: When was Cultbeauty.co.uk registered?
A: Cultbeauty.co.uk was registered 17 years, 4 months, 2 weeks, 4 days, 7 hours, 38 minutes, 12 seconds ago on Monday, February 7, 2005.
Q: When was the WHOIS for Cultbeauty.co.uk last updated?
A: The WHOIS entry was last updated 9 months, 1 week, 1 day, 7 hours, 38 minutes, 12 seconds ago on Friday, September 17, 2021.
Q: What are Cultbeauty.co.uk's nameservers?
A: DNS for Cultbeauty.co.uk is provided by the following nameservers:
  • dns1.p05.nsone.net
  • dns2.p05.nsone.net
  • dns3.p05.nsone.net
  • dns4.p05.nsone.net
Q: Who is the registrar for the Cultbeauty.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Cultbeauty.co.uk?
A: Cultbeauty.co.uk ranks 22,291 globally on Alexa. Cultbeauty.co.uk has a Low Trust Score, and a Statvoo Rank of C.
Q: How many people visit Cultbeauty.co.uk each day?
A: Cultbeauty.co.uk receives approximately 78,956 visitors and 473,736 page impressions per day.
Q: What IP address does Cultbeauty.co.uk resolve to?
A: Cultbeauty.co.uk resolves to the IPv4 address .
Q: In what country are Cultbeauty.co.uk servers located in?
A: Cultbeauty.co.uk has servers located in the .
Q: What webserver software does Cultbeauty.co.uk use?
A: Cultbeauty.co.uk is powered by webserver.
Q: Who hosts Cultbeauty.co.uk?
A: Cultbeauty.co.uk is hosted by Unknown in .
Q: How much is Cultbeauty.co.uk worth?
A: Cultbeauty.co.uk has an estimated worth of $681,840. An average daily income of approximately $947, which is roughly $28,805 per month.

Cultbeauty.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Cultbeauty.co.uk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Cultbeauty.co.uk

H1 Headings

0 :

H2 Headings

16 :
  1. NEW FROM VERSED
  2. 20% OFF DRUNK ELEPHANT
  3. THE CULT BEAUTY CHRISTMAS EDITS
  4. NEW FROM BYREDO
  5. NEW FROM PAULA’S CHOICE
  6. NEW FROM HUDA BEAUTY
  7. NEW FROM VERSED
  8. 20% OFF DRUNK ELEPHANT
  9. BESTSELLERS
  10. added to your bag
  11. Quick Buy
  12. TRENDING
  13. added to your bag
  14. Quick Buy
  15. INSIDER INFORMATION
  16. GET 15% OFF YOUR FIRST ORDER

H3 Headings

36 :
  1. Drunk Elephant Trunk 5.0
  2. SAVE 20% & FREE SHIPPING
  3. Augustinus Bader The Cream 50ml
  4. Cult Beauty More Indulgence
  5. Charlotte Tilbury Charlotte's Magic Cream Moisturiser
  6. NARS Cosmetics Radiant Creamy Concealer (Various Shades)
  7. RevitaLash Advanced Eyelash Conditioner 2 ml
  8. Olaplex No.3 Hair Perfector Supersize 250ml
  9. 20% SAVING
  10. Cult Beauty More Glam
  11. Sol de Janeiro Brazilian Bum Bum Cream 75ml
  12. Le Labo Santal 33 - Eau De Parfum
  13. Naked Grapefruit First Base
  14. NEW & EXCLUSIVE
  15. VIRTUE
  16. DISCOVER
  17. CHRISTMAS SHOP
  18. NEW & EXCLUSIVE
  19. NESSA ORGANICS
  20. FOREO UFO 2 Skincare Secrets Gift Set
  21. Cult Beauty More Self Care
  22. Omorovicza Blue Diamond Concentrate (30ml)
  23. Olaplex Healthy Hair Essentials Kit
  24. benefit Exclusive Winter Glammin' Gift Set (Worth £103.00)
  25. 50% SAVING
  26. Natasha Denona Christmas Kit (Worth £36.00)
  27. Escentric Molecules Molecule 01 (100ml)
  28. LELO Sila Sonic Massager - Lilac
  29. Augustinus Bader The Serum
  30. Biossance Squalane and Probiotic Gel Moisturiser 50ml
  31. BEAUTY NEWS
  32. JOIN THE MENOPAUSE REVOLUTION
  33. BRAND OF THE MONTH
  34. DRUNK ELEPHANT IS OUR CULT BRAND OF THE MONTH!
  35. BEAUTY NEWS
  36. MAKE UP OF THE MOMENT: NEW RELEASES YOU’LL LOVE

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

49 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

625:

Links - Outbound (nofollow)

0:

Keyword Cloud for Cultbeauty.co.uk

drunk elephanttools nbsphome view20 offup5brushestoolsconditionerbumfirstglowbrowsbathbasejoinshampoonarscreamsdiscover discoverproductsbrushes make upbalmstools nbsphomefreenbsphome viewcleansingnightmistssave 20informationoffblusherallfragranceviewhyperpigmentation top 10night timegifthyperpigmentation topheroescult concierge0continuebrowcosmeticssorryyoudark circlesbeauty ukbrushes makebeen an errorcaretop 10drytoners mistsourlimitedyourvalueconcealerhyperpigmentationprotectionretinolshopmoisturiserswellbeinggift setlipserumsapplicatorscolourtopsalecategory shopcare nbsphomeskincarepolicyexclusivecategory nbsphomecult beauty moreshampoo conditionerlip carechangeerrorproductradiantstockcult beautyselfhair carevalue setsgetusereadremoversbenefittry again6cream7kitsavebronzerseemssorry there seemsaddgelscirclesshadeshomebodydiscover nbsphome newsupplementsplease try againhighlighterpalettes2offerssetsmore informationtanningcultexfoliatebath bodyblueminirevitalashthere seemssorry theretilburyserumbuycare luxekeyvitamin cpleasefree shippingquantitynew1nbsphome view allukbeenbrandsmoreingredientgbpeyelasheye caredrunkcontinue shoppingdiscover nbsphomecharlotte tilbury3shop nowmenopausediscover discover nbsphomedarkunknownaugustinus baderitemsagainexfoliatorsshop now newcleansershairnbsphometrynbsphome newskinessentialsshop by categoryshippingtreatments hairletcult beauty ukbeauty moreskin careelephantluxediscovercbag cult beautyhair treatmentsstarsadd to bagbasketnow newplease tryparttreatmentsolaplexcare nbsphome viewusacidcharlottesign upeditsnowconciergebaderlisttimemake uperror please trymascaragiftseyeyour bagmakefacevitaminfoundationeyesseems to haveenjoyread moretonersitems in yoursetview allcategory nbsphome viewworthbrand4complexionbag cultspf50mlbeautyconcerntheremasksaugustinusyour basketcategoryreviewschristmasperfectitemhaveemailbagup to ourmonthhave beenshoppingerror pleasesavingcollectionstravelsignoilshair masksmoisturiser

Longtail Keyword Density for Cultbeauty.co.uk

KeywordsOccurences
nbsphome view all42
add to bag21
shop by category6
cult beauty more6
care nbsphome view6
please try again5
discover discover nbsphome5
discover nbsphome new5
items in your5
shop now new5
error please try5
sorry there seems4
seems to have4
been an error4
cult beauty uk3
bag cult beauty3
brushes make up3
tools nbsphome view3
hyperpigmentation top 103
category nbsphome view3
up to our3
view all46
nbsphome view42
top 1029
make up26
cult beauty15
shop now14
skin care11
hair care11
read more8
try again7
bath body7
now new6
beauty more6
your basket6
drunk elephant6
care nbsphome6
continue shopping5
have been5
error please5
nbsphome new5
discover nbsphome5
discover discover5
please try5
20 off4
treatments hair4
there seems4
sorry there4
night time4
augustinus bader4
charlotte tilbury4
gift set4
vitamin c4
save 203
category shop3
your bag3
bag cult3
more information3
cult concierge3
hair treatments3
category nbsphome3
free shipping3
value sets3
shampoo conditioner3
brushes make3
tools nbsphome3
lip care3
beauty uk3
eye care3
toners mists3
care luxe3
hyperpigmentation top3
hair masks3
dark circles3
sign up3
nbsphome56
hair54
view51
all48
care39
up34
new34
top32
029
shop28
bag27
make27
beauty25
skin25
your24
cult23
body22
add21
more19
now18
tools16
fragrance15
face14
luxe13
discover13
gifts12
lip12
sets12
stars11
reviews11
wellbeing11
treatments10
our10
cream10
eye10
110
night9
read9
bath9
brands9
spf9
brow8
time8
items7
again7
try7
concealer7
brushes7
products7
christmas7
you7
masks6
26
please6
been6
quantity6
have6
basket6
category6
moisturiser6
acid6
moisturisers6
drunk6
there6
supplements6
36
saving6
elephant6
exclusive6
gift6
off6
oils5
home5
toners5
mists5
serums5
creams5
first5
skincare5
travel5
mini5
tanning5
cleansing5
conditioner5
45
shopping5
product5
edits5
collections5
kit5
policy5
error5
email5
55
65
us5
olaplex5
continue5
worth4
menopause4
set4
let4
74
bum4
free4
shipping4
part4
50ml4
bader4
augustinus4
shampoo4
seems4
sorry4
shades4
serum4
item4
exfoliators4
mascara4
concern4
hyperpigmentation4
charlotte4
tilbury4
retinol4
c4
vitamin4
ingredient4
cleansers4
foundation4
balms4
unknown4
brand4
change4
gbp4
information4
enjoy3
heroes3
protection3
uk3
buy3
month3
blue3
join3
limited3
save3
value3
use3
stock3
get3
concierge3
key3
palettes3
colour3
dark3
dry3
eyelash3
applicators3
brows3
eyes3
bronzer3
highlighter3
complexion3
self3
essentials3
offers3
sale3
removers3
circles3
gels3
exfoliate3
list3
revitalash3
nars3
cosmetics3
perfect3
glow3
radiant3
benefit3
base3
blusher3
sign3

Who hosts Cultbeauty.co.uk?

Cultbeauty.co.uk Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Not Applicable

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.6445%
GOOGLE
14.1050%
AS-26496-GO-DADDY-COM-LLC
3.4726%
NAMECHEAP-NET
3.1524%
AMAZON-AES
2.2226%
GoDaddy.com, LLC
2.0265%
UNIFIEDLAYER-AS-1
1.9734%
Fara Negar Pardaz Khuzestan
1.6251%
CONFLUENCE-NETWORK-INC
1.4696%
AMAZON-02
1.3660%

HTTP Header Analysis for Cultbeauty.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200
Server-Timing: dtRpid;desc="-1930308496"
X-OneAgent-JS-Injection: true
Cache-Control: private, max-age=0, no-cache, no-store, must-revalidate
Pragma: no-cache
Expires: Thu, 01 Jan 1970 00:00:00 GMT
X-Frame-Options: SAMEORIGIN
X-Content-Type-Options: nosniff
Content-Security-Policy: child-src 'self' https://www.googletagmanager.com https://*.liveperson.net https://cdn.appdynamics.com https://*.lpsnmedia.net https://www.facebook.com https://connect.facebook.net https://*.google.com https://widget.trustpilot.com https://*.doubleclick.net https://*.akamaihd.net https://*.translate.naver.net https://www.recaptcha.net https://www.google.com https://www.zenaps.com https://tr.snapchat.com https://tr6.snapchat.com https://www.youtube.com https://*.googlesyndication.com https://mc.yandex.ru blob: https://www.provenance.org; connect-src 'self' https://*.thcdn.com https://*.ingest.sentry.io https://*.pingdom.net https://*.doubleclick.net https://*.google-analytics.com https://capture.trackjs.com https://fp.zenaps.com https://www.facebook.com https://*.google.com https://*.thehut.net https://the.sciencebehindecommerce.com https://*.akamaihd.net https://*.googleapis.com https://*.trustpilot.com https://*.doubleclick.net https://*.bing.com https://connect.facebook.net https://*.contentsquare.net https://mc.yandex.ru https://ymetrica1.com https://*.parcellab.com; default-src 'none'; font-src 'self' data: https://*.thcdn.com https://fp.zenaps.com https://cdnjs.cloudflare.com https://fonts.gstatic.com https://fonts.googleapis.com https://yastatic.net; form-action 'self' https://www.facebook.com https://checkout.cultbeauty.co.uk https://connect.facebook.net https://tr.snapchat.com; frame-ancestors 'self'; img-src 'self' data: https://*.thcdn.com https://col.eum-appdynamics.com https://usage.trackjs.com https://*.lpsnmedia.net https://*.doubleclick.net https://www.google-analytics.com https://*.google.com https://cx.atdmt.com https://www.zenaps.com https:; media-src 'self' https://*.thcdn.com https://*.lpsnmedia.net; object-src 'self' https://*.thcdn.com https://www.youtube.com; report-uri https://csp.thehut.net/cspReport.txt; script-src 'self' 'unsafe-eval' 'unsafe-inline' data: https://*.thcdn.com https://*.thehut.net https://rum-static.pingdom.net https://*.liveperson.net https://*.lpsnmedia.net https://*.doubleclick.net https://static.cdn-apple.com https://*.liveperson.com https://www.googletagmanager.com https://fp.zenaps.com https://www.youtube.com https://*.google-analytics.com https://*.google.com https://google.com https://connect.facebook.net https://bat.bing.com https://widget.trustpilot.com https://s.ytimg.com https://www.googletagservices.com https://*.googleapis.com https://www.facebook.com https://www.googleadservices.com https://*.gstatic.com https://*.gstatic.cn https://www.dwin1.com https://seal.digicert.com https://static.criteo.net https://*.criteo.com https://remote.captcha.com https://*.akamaihd.net https://ln-rules.rewardstyle.com https://*.baidu.com https://*.recaptcha.net https://*.sciencebehindecommerce.com https://sc-static.net https://*.shoplooks.com https://slooks.top https://slooks.me https://*.translate.naver.net https://*.microsofttranslator.com https://*.hotjar.com https://*.attn.tv https://*.trustpilot.com https://*.bing.com https://*.doubleclick.net https://static.ads-twitter.com https://analytics.twitter.com https://*.google.co.uk https://google.co.uk https://analytics.tiktok.com https://*.ibytedtos.com https://*.liveperson.com https://tpc.googlesyndication.com https://mc.yandex.com https://mc.yandex.ru https://yastatic.net https://unpkg.com/@provenance/; style-src 'self' 'unsafe-inline' https://*.thcdn.com https://*.google.com https://*.googleapis.com https://fp.zenaps.com https://cdnjs.cloudflare.com https://*.googleapis.com https://*.translate.naver.net https://*.microsofttranslator.com https://cdn.parcellab.com https://drj5wi2x4lz96.cloudfront.net/css/embed.css; upgrade-insecure-requests; report-to report-endpoint
Referrer-Policy: unsafe-url
X-XSS-Protection: 1; mode=block; report=/xssProtection.txt
Report-To: {"group":"report-endpoint","max_age":86400,"endpoints":[{"url":"https://www.cultbeauty.co.uk/cspReport.txt","priority":1,"weight":1}],"include_subdomains":true}
vary: accept-encoding
Content-Encoding: gzip
Content-Type: text/html;charset=UTF-8
Transfer-Encoding: chunked
Date: Sat, 23 Oct 2021 03:38:49 GMT

Cultbeauty.co.uk Domain Nameserver Information

HostIP AddressCountry
dns1.p05.nsone.net 198.51.44.5
dns2.p05.nsone.net 198.51.45.5
dns3.p05.nsone.net 198.51.44.69
dns4.p05.nsone.net 198.51.45.69


Need to find out who hosts Cultbeauty.co.uk?


Domain Registration (WhoIs) information for Cultbeauty.co.uk

 Domain name:
cultbeauty.co.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 10-Dec-2012

Registrar:
Safenames Ltd [Tag = SAFENAMES]
URL: http://www.safenames.net

Relevant dates:
Registered on: 07-Feb-2005
Expiry date: 07-Feb-2023
Last updated: 17-Sep-2021

Registration status:
Registered until expiry date.

Name servers:
dns1.p05.nsone.net
dns2.p05.nsone.net
dns3.p05.nsone.net
dns4.p05.nsone.net

WHOIS lookup made at 04:38:52 23-Oct-2021

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2021.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Websites with Similar Names

Cultb.com
HugeDomains.com
Cultbabes.com
React App
Cultband.com
403 Forbidden
Cultbarbershop.com
Cult Barbershop. Минск
Cultbase.com
HugeDomains.com - Shop for over 300,000 Premium Domains
Cultbay.com
CultBay Steigern Sie Ihren Umsatz
Cultbeautie.com
Domain Registered at Safenames
Cultbeauty.co.uk
Shop The World's Best Beauty Buys | Cult Beauty

Recently Updated Websites

Trennplex.com (3 seconds ago.)Quizier.com (8 seconds ago.)Mediamarketingmethods.org (12 seconds ago.)Getcuttingtools.net (13 seconds ago.)Wpcharms.com (17 seconds ago.)Megandaleyinteriors.com (21 seconds ago.)Smileything.com (21 seconds ago.)Novakidschool.com (22 seconds ago.)Portfolio.amynnasser.com (22 seconds ago.)Nasadovode.ru (22 seconds ago.)Lanou3g.com (23 seconds ago.)Uberrequirements.net (26 seconds ago.)Visionliaison.com (26 seconds ago.)Inkopious.com (29 seconds ago.)Ds1.newvisionuganda.info (29 seconds ago.)Lizetbeek.nl (31 seconds ago.)Sta-sail.com (32 seconds ago.)121hrsolutions.co.uk (32 seconds ago.)Topxml.com (33 seconds ago.)Ybty2079.com (35 seconds ago.)Kchcommunities.com (38 seconds ago.)I27.tinypic.com (39 seconds ago.)Candyclub.info (39 seconds ago.)Businessinvestment.us (40 seconds ago.)Slotsky777.xyz (40 seconds ago.)Leshackdefruitsdemer.com (41 seconds ago.)Conhecimento.sebraers.com.br (43 seconds ago.)Informitv.com (44 seconds ago.)Increate.org (44 seconds ago.)Thesaguaro.com (46 seconds ago.)

Recently Searched Keywords

ongoing monitoring (1 second ago.)nd filter (1 second ago.)toolsnbspnbsp3 (1 second ago.)apparecchiature (1 second ago.)iosslider-col-2 iosslider-col-2 (1 second ago.)wild birds unlimited billings mt (2 seconds ago.)terbaru kepada (2 seconds ago.)dnsjson (3 seconds ago.)oja (3 seconds ago.)courses data (3 seconds ago.)december 17, 2017 at 1:39 am (3 seconds ago.)anavadya meaning (4 seconds ago.)air duct cleaning houston (5 seconds ago.)07tpasectionigqcvhwg (5 seconds ago.)unterwäsche damen (5 seconds ago.)oppo r17 (5 seconds ago.)trincadeira (6 seconds ago.)carousel-top-cities-storage (7 seconds ago.)middot middot middot (7 seconds ago.)bocacalle meaning (8 seconds ago.)node29 (8 seconds ago.)domestic (8 seconds ago.)gm hybrids and evs (8 seconds ago.)led professional lighting (8 seconds ago.)gm hybrids and evs (9 seconds ago.)vraagteken in english (9 seconds ago.)3px border-left-width (10 seconds ago.)number of important factors (10 seconds ago.)kwun (10 seconds ago.)custom (11 seconds ago.)