Website Analysis Summary  |  Free Motorcycle Classifieds - Buy & Sell - Used Motorcycles For Sale
Low trust score  | 
Free Motorcycle Classifieds - Buy & Sell - Used Motorcycles For Sale

Trust Score
Low Trust Score
Estimated worth
Estimated daily income
Estimated monthly income
0 has a Low Trust Score, and a Statvoo Rank of G. is hosted by CloudFlare, Inc. in United States. has an IP Address of and a hostname of

The domain was registered 1 decade 5 years 2 months ago by , it was last modified 4 years 8 months 3 weeks ago and currently is set to expire 2 years 2 months 5 days ago.

It is the world's 184,127 most popular site among over 300 million websites. has a total of 0 backlinks. gets approximately 9,081 unique visitors a day and 45,405 pageviews per day. has an estimated worth of $68,400.
An average daily income of approximately $114, which is wroughly $3,468 per month.

Whois information for

Full Whois Lookup for Whois Lookup

Domain ID: D7048325-US
Sponsoring Registrar: GOOGLE INC.
Sponsoring Registrar IANA ID: 895
Registrar URL (registration services):
Domain Status: clientTransferProhibited
Registrant ID: GO2023056340
Registrant Name: Jay Gaulard
Registrant Organization: ILEEG Inc
Registrant Address1: Hennessey Rd
Registrant Address2: Industry, ME 04938
Registrant City: Industry
Registrant State/Province: ME
Registrant Postal Code: 04938
Registrant Country: United States
Registrant Country Code: US
Registrant Phone Number: +1.8605980842
Registrant Email: Login to show email
Application Purpose: P1
Registrant Nexus Category: C11
Administrative Contact ID: GO2023056340
Administrative Contact Name: Jay Gaulard
Administrative Contact Organization: ILEEG Inc
Administrative Contact Address1: Hennessey Rd
Administrative Contact Address2: Industry, ME 04938
Administrative Contact City: Industry
Administrative Contact State/Province: ME
Administrative Contact Postal Code: 04938
Administrative Contact Country: United States
Administrative Contact Country Code: US
Administrative Contact Phone Number: +1.8605980842
Administrative Contact Email: Login to show email
Application Purpose: P1
Administrative Nexus Category: C11
Billing Contact ID: GO2023056340
Billing Contact Name: Jay Gaulard
Billing Contact Organization: ILEEG Inc
Billing Contact Address1: Hennessey Rd
Billing Contact Address2: Industry, ME 04938
Billing Contact City: Industry
Billing Contact State/Province: ME
Billing Contact Postal Code: 04938
Billing Contact Country: United States
Billing Contact Country Code: US
Billing Contact Phone Number: +1.8605980842
Billing Contact Email: Login to show email
Application Purpose: P1
Billing Nexus Category: C11
Technical Contact ID: GO2023056340
Technical Contact Name: Jay Gaulard
Technical Contact Organization: ILEEG Inc
Technical Contact Address1: Hennessey Rd
Technical Contact Address2: Industry, ME 04938
Technical Contact City: Industry
Technical Contact State/Province: ME
Technical Contact Postal Code: 04938
Technical Contact Country: United States
Technical Contact Country Code: US
Technical Contact Phone Number: +1.8605980842
Technical Contact Email: Login to show email
Application Purpose: P1
Technical Nexus Category: C11
Last Updated by Registrar: GOOGLE INC.
Last Transferred Date: Mon Jan 02 18:33:06 GMT 2017
Domain Registration Date: Sun Dec 12 01:02:20 GMT 2004
Domain Expiration Date: Tue Dec 11 23:59:59 GMT 2018
Domain Last Updated Date: Mon Jan 02 19:06:59 GMT 2017
DNSSEC: true

>>>> Whois database was last updated on: Sun Aug 27 19:47:13 GMT 2017

Who hosts Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:CloudFlare, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 04 Jun 2015 07:49:50 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: max-age=1, private, must-revalidate
Expires: Sat, 26 Jul 1997 05:00:00 GMT
Vary: Accept-Encoding
Server: cloudflare-nginx
CF-RAY: 1f120b1e154106ee-LHR
Content-Encoding: gzip

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:1
H2 Headings:1
H3 Headings:1
H4 Headings:1
H5 Headings:1
H6 Headings:1
Total IFRAMEs:0
Total Images:19
Google Adsense:pub-0850155048090140
Google Analytics:UA-4188631-3

Keyword Cloud for

special125ccroller1984 yamahabikesmotorcyclesdual purposeglideblackhigh roller4texasyamaha1dualnewadsbygoogle windowadsbygoogle push2vehicletouring5motorcycle classifiedsadsbygooglecarolinasoftailfree motorcycle classifiedspurposeusedharley davidson03cvo ultrasuzukifreestreetvaronecvo ultra limitedmotorcyclecustomsellcityharleystreet legaladsbygoogle windowadsbygoogleusechromewindowadsbygoogle6sanpushroad glideeaglesportlegalnorthdavidsonclassifiedsvirginiaampmileswindowadsbygoogle pushillinoisadscvofree motorcycleminiultralimitedhighlastonlyitsultra limitedexhaustengineroad

Longtail Keyword Density for

adsbygoogle windowadsbygoogle push5
cvo ultra limited4
free motorcycle classifieds3
harley davidson5
windowadsbygoogle push5
adsbygoogle windowadsbygoogle5
road glide5
street legal4
dual purpose4
ultra limited4
free motorcycle4
motorcycle classifieds4
cvo ultra4
high roller3
1984 yamaha3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry