Cylex.de  |  Cylex-Branchenbuch Deutschland
Low trust score  | 
Das Cylex-Branchenbuch Deutschland ist ein Online-Branchenbuch in Form eines Community-Portals. Hier können Sie Adressen, Beschreibungen und Karten der Firmen finden. Es gibt hier auch Bewertungen von Benutzern, wobei auch Sie Ihre Bewertung über die Produkte und Dienstleistungen, die die Firmen anbieten, abgeben können.




Cylex.de Website Information

Website Ranks & Scores for Cylex.de

Statvoo Rank Statvoo Rank:D
Alexa Rank Alexa Rank:19,748
Majestic Rank Majestic Rank:32,521
Domain Authority Domain Authority:76%
DMOZ DMOZ Listing:No

Whois information for cylex.de

Full Whois Lookup for Cylex.de Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Cylex.de. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: cylex.de
Nserver: ns1.kon.de
Nserver: ns2.cylex.de 62.217.61.161
Nserver: office-gw.cylex.de 213.69.255.221
Status: connect
Changed: 2010-01-08T17:11:29+01:00

[Tech-C]
Type: PERSON
Name: Franz Osvald
Organisation: S.C. CYLEX TEHNOLOGIA INFORMATIEI INTERNATIONAL S.N.C.
Address: Sat Palota NR. 119
PostalCode: 417516
City: Palota
CountryCode: RO
Phone: +40.359101185
Fax: +40.259471392
Email: Login to show email
2009-12-21T15:15:31+01:00

[Zone-C]
Type: PERSON
Name: Franz Osvald
Organisation: S.C. CYLEX TEHNOLOGIA INFORMATIEI INTERNATIONAL S.N.C.
Address: Sat Palota NR. 119
PostalCode: 417516
City: Palota
CountryCode: RO
Phone: +40.359101185
Fax: +40.259471392
Email: Login to show email
2009-12-21T15:15:31+01:00

Who hosts Cylex.de?

Cylex.de is hosted by OBone GmbH in Rheinland-pfalz, Oberhausen, Germany, 46047.
Cylex.de has an IP Address of 62.217.61.166 and a hostname of cylex.62217061166.obone.de.



Cylex.de Web Server Information

Hosted IP Address:62.217.61.166
Hosted Hostname:cylex.62217061166.obone.de
Service Provider:OBone GmbH
Hosted Country:GermanyDE
Location Latitude:49.0969
Location Longitude:8.05833
Webserver Software:Not Applicable

HTTP Header Analysis for Cylex.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-Powered-By: ASP.NET
X-UA-Compatible: IE=edge
Date: Thu, 11 Jun 2015 00:59:05 GMT
Content-Length: 19826


Need to find out who hosts Cylex.de?

Cylex.de Free SEO Report

Website Inpage Analysis for Cylex.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Cylex.de

limitslides collect falsedocumentreadyfunctionelsemehrsidenavremoveclassactive sidenavoverlayremoveclassactive0lawyersheadingattrclasscasepetrolstationheadingchangeelementtypep petrolstationheadingattrclass h1break casedatahidden searchwhatcssdisplayblockdoctorsheadingattrclasshugehheadingifberhidden petrolstationheadingchangeelementtypep petrolstationheadingattrclasstruefrinfinite trueunternehmenh1 hiddenpetrolstationheadingattrclass h1slidescylexdeslider varderhidden searchwhatcssdisplayblock breakvgeodiszip vgeodiszipelse ifvisibleiconihnenmorelessangebotescrolltoppetrolstationheadingchangeelementtypep petrolstationheadingattrclassfunctionoderunternehmen findensidenavoverlayremoveclassactiveampetrolstationheadingattrclasscreditsafecollectmitsearchwhatcssdisplayblocksearchwhatcssdisplayblock breakheaderremoveclassbackpetrolstationimgvgeodiszipdoctorsheadingattrclass h1 hiddenh1 hidden lawyersheadingchangeelementtypepinformationendoctorsheadingattrclass h1paginationpetrolstationheadingchangeelementtypepsearchwhatcssdisplayblock break casevalueheaderremoveclassbackbussinessimgfalseslides collecth1 hidden searchwhatcssdisplayblockheaderremoveclassbackdoctorsimgbreakvarknnenpetrolstationheadingattrclass h1 hiddendirectoryheadingattrclass h1findenvgeoregiondisplayfalse visiblecollect false visibledoctorsheadingchangeelementtypep doctorsheadingattrclass h1collect falsehidden petrolstationheadingchangeelementtypeplawyersheadingchangeelementtypepheaderremoveclassbacklawyersimgampinfinitesliderdirectoryheadingattrclass h1 hiddenvon1finden siesidenavremoveclassactiveaushiddendiecitycylexdirectoryheadingchangeelementtypepeinehidden lawyersheadingchangeelementtypepfielddoctorsheadingchangeelementtypep doctorsheadingattrclassreturndirectoryheadingchangeelementtypep directoryheadingattrclass h1h1zudirectoryheadingchangeelementtypep directoryheadingattrclassimsiedirectoryheadingattrclasswidthurldoctorsheadingchangeelementtypep2vgeocitybranchenbuch3

Longtail Keyword Density for Cylex.de

KeywordsOccurences
slides collect false3
collect false visible3
doctorsheadingchangeelementtypep doctorsheadingattrclass h13
doctorsheadingattrclass h1 hidden3
h1 hidden lawyersheadingchangeelementtypep3
hidden petrolstationheadingchangeelementtypep petrolstationheadingattrclass3
petrolstationheadingchangeelementtypep petrolstationheadingattrclass h13
petrolstationheadingattrclass h1 hidden3
h1 hidden search-whatcssdisplayblock3
hidden search-whatcssdisplayblock break3
search-whatcssdisplayblock break case3
directoryheadingchangeelementtypep directoryheadingattrclass h13
directoryheadingattrclass h1 hidden3
h1 hidden11
break case6
vgeodiszip vgeodiszip4
finden sie4
unternehmen finden3
directoryheadingchangeelementtypep directoryheadingattrclass3
search-whatcssdisplayblock break3
hidden search-whatcssdisplayblock3
petrolstationheadingattrclass h13
petrolstationheadingchangeelementtypep petrolstationheadingattrclass3
hidden petrolstationheadingchangeelementtypep3
hidden lawyersheadingchangeelementtypep3
doctorsheadingchangeelementtypep doctorsheadingattrclass3
doctorsheadingattrclass h13
false visible3
collect false3
slides collect3
infinite true3
slider var3
sidenavremoveclassactive sidenav-overlayremoveclassactive3
else if3
directoryheadingattrclass h13
amp40
var21
if19
sie15
function15
hidden14
h111
else9
vgeodiszip8
case8
break8
documentreadyfunction8
url6
oder6
zu6
finden6
unternehmen6
true6
angebote5
directoryheadingattrclass4
hugeh-heading4
doctorsheadingattrclass4
false4
04
vgeoregiondisplay4
vgeocity4
field4
city4
petrolstationheadingattrclass4
value4
data4
ber4
cylex4
die4
branchenbuch4
im4
fr4
eine4
der4
headerremoveclassback-doctors-img3
headerremoveclassback-lawyers-img3
headerremoveclassback-petrolstation-img3
ihnen3
headerremoveclassback-bussiness-img3
informationen3
aus3
doctorsheadingchangeelementtypep3
von3
moreless3
lawyersheadingchangeelementtypep3
lawyersheadingattrclass3
petrolstationheadingchangeelementtypep3
13
search-whatcssdisplayblock3
directoryheadingchangeelementtypep3
mehr3
collect3
width3
23
am3
33
creditsafe3
cylexde3
limit3
return3
scrolltop3
mit3
visible3
sidenavremoveclassactive3
sidenav-overlayremoveclassactive3
slider3
pagination3
infinite3
slides3
knnen3
icon3

What are the nameservers for cylex.de?

Cylex.de Domain Nameserver Information

HostIP AddressCountry
ns1.kon.de 81.88.32.17Germany Germany
ns2.cylex.de 62.217.61.161Germany Germany
office-gw.cylex.de 213.69.255.221Germany Germany

Cylex.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Cylex.de is a scam?