Danskebank.dk  |  Privat - Danske Bank
Low trust score  | 
RĂ„dgivning samt finansielle bank- og realkreditprodukter til privat og erhverv.




Danskebank.dk Website Information

Website Ranks & Scores for Danskebank.dk

Statvoo Rank Statvoo Rank:E
Alexa Rank Alexa Rank:13,781
Majestic Rank Majestic Rank:128,591
Domain Authority Domain Authority:68%
DMOZ DMOZ Listing:No

Whois information for danskebank.dk

Full Whois Lookup for Danskebank.dk Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Danskebank.dk. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

# Hello 2a01:7e00::f03c:91ff:fe84:f734. Your session has been logged.
#
# Copyright (c) 2002 - 2017 by DK Hostmaster A/S
#
# Version: 2.0.2
#
# The data in the DK Whois database is provided by DK Hostmaster A/S
# for information purposes only, and to assist persons in obtaining
# information about or related to a domain name registration record.
# We do not guarantee its accuracy. We will reserve the right to remove
# access for entities abusing the data, without notice.
#
# Any use of this material to target advertising or similar activities
# are explicitly forbidden and will be prosecuted. DK Hostmaster A/S
# requests to be notified of any such activities or suspicions thereof.

Domain: danskebank.dk
DNS: danskebank.dk
Registered: 1996-02-02
Expires: 2018-03-31
Registration period: 1 year
VID: no
Dnssec: Signed delegation
Status: Active

Nameservers
Hostname: ns1.p20.dynect.net
Hostname: ns2.p20.dynect.net
Hostname: ns3.p20.dynect.net
Hostname: ns4.p20.dynect.net

# Use option --show-handles to get handle information.
# Whois HELP for more help.

Who hosts Danskebank.dk?

Danskebank.dk is hosted by Den Danske Bank A/S in Midtjylland, Stavtrup, Denmark, 8220.
Danskebank.dk has an IP Address of 212.93.36.130 and a hostname of 212.93.36.130.



Danskebank.dk Web Server Information

Hosted IP Address:212.93.36.130
Hosted Hostname:212.93.36.130
Service Provider:Den Danske Bank A/S
Hosted Country:DenmarkDK
Location Latitude:56.1312
Location Longitude:10.1199
Webserver Software:unknown

HTTP Header Analysis for Danskebank.dk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: Keep-Alive
Expires: Fri, 12 Jun 2015 00:29:50 GMT
Date: Fri, 12 Jun 2015 00:05:44 GMT
Content-Type: text/html; charset=utf-8
Cache-Control: private
Vary: Accept-Encoding
SPRequestGuid: 6ee373d2-27f7-4cbb-a856-87682cb26885
X-SharePointHealthScore: 0
X-Powered-By: ASP.NET
MicrosoftSharePointTeamServices: 14.0.0.7149
X-MS-InvokeApp: 1; RequireReadOnly
Content-Encoding: gzip
Transfer-Encoding: chunked


Need to find out who hosts Danskebank.dk?

Danskebank.dk Free SEO Report

Website Inpage Analysis for Danskebank.dk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Danskebank.dk

screeneller9helefra3medalle produktervedk248be boligfeedbackandreringletbankdocumentlocationhref privatsoegq inputenter70 123sygdompopupdisplay right 0popupdisplaycloserevealmodaldanske bankbookameetinggenericreceiptrevealmodalfullos paf645 708kortbliv kundelukvalutatilderring tilprivatsoegq inputrightelsedocumentlocationhref123 45610 17 08dineog0800popupdisplay rightinvesteringepension10 17ersep229cookies08vejbookl230s0 0forsikring0findkanjune7mobilepayreturn falsebarnifforeninger70 10familienblivimportantkundedanskering til osfunction datadit410siteshj230lp1boligdocumentlocationhref privatsoegq2left0varp229 vejprivatkeycodenetbankprivatsoegqoslogurlprissprafdelingfunction ifmediadu5til os70 10 17digdatatab2finanstilsynetlivfalseskalflyttealledinmderight 0jquerykontimedia screenreturnbookameetinggeneralreceiptrevealmodalfulldu skall230s merebankp70 20functionvi70 123 456support45 70 123d248dsfaldproduktervoresnetpostfind hj230lpiek248betopommobilbankjobhvadinputcolorgeolocation0pxl248nmere17 08amperhverv

Longtail Keyword Density for Danskebank.dk

KeywordsOccurences
70 123 4564
documentlocationhref privatsoegq input4
ring til os4
popupdisplay right 03
70 10 173
45 70 1233
10 17 083
l230s mere8
til os6
bliv kunde6
danske bank6
du skal5
documentlocationhref privatsoegq4
function data4
return false4
find hj230lp4
privatsoegq input4
70 204
ring til4
alle produkter4
45 704
70 1234
123 4564
right 03
popupdisplay right3
os p3
media screen3
0 03
17 083
p229 vej3
k248be bolig3
70 103
10 173
function if3
til20
var18
if16
og16
015
alle15
114
function13
du13
find13
p12
bolig12
os12
danske11
mere10
bank10
kort9
important9
din9
l230s8
netbank8
skal8
bliv8
eller8
kunde8
input8
p2297
flytte7
vi7
popupdisplay6
produkter6
afdeling6
documentlocationhref6
url6
return6
se6
false6
tab25
pension5
top5
dit5
dig5
hj230lp5
mde5
e5
24
screen4
media4
jquery4
34
44
54
close-reveal-modal4
keycode4
hvad4
data4
luk4
64
er4
0px4
privatsoegq4
geolocation4
74
barn4
familien4
sygdom4
d248dsfald4
amp4
konti4
08004
med4
ved4
kan4
privat4
erhverv4
log4
foreninger4
june4
job4
book4
84
94
support4
ring4
pris4
ie3
color3
vores3
finanstilsynet3
liv3
book-a-meeting-generic-receiptreveal-modalfull3
sites3
andre3
hele3
book-a-meeting-general-receiptreveal-modalfull3
spr3
l248n3
left03
cookies3
right3
103
vej3
enter3
feedback3
k248be3
mobilbank3
forsikring3
valuta3
else3
fra3
083
letbank3
investering3
dine3
netpost3
mobilepay3
om3
der3
af3

What are the nameservers for danskebank.dk?

Danskebank.dk Domain Nameserver Information

HostIP AddressCountry
ns4.p20.dynect.net 204.13.251.20United States United States
ns3.p20.dynect.net 208.78.71.20United States United States
ns2.p20.dynect.net 204.13.250.20United States United States
ns1.p20.dynect.net 208.78.70.20United States United States

Danskebank.dk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Danskebank.dk is a scam?