Low trust score |
Rådgivning samt finansielle bank- og realkreditprodukter til privat og erhverv.
Danskebank.dk Website Information
Website Ranks & Scores for Danskebank.dk
 Statvoo Rank: | E |
 Alexa Rank: | 13,781 |
 Majestic Rank: | 128,591 |
 Domain Authority: | 68% |
 DMOZ Listing: | No |
Whois information for danskebank.dk
Full Whois Lookup for Danskebank.dk Whois Lookup
WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Danskebank.dk. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.
# Hello 2a01:7e00::f03c:91ff:fe84:f734. Your session has been logged.
#
# Copyright (c) 2002 - 2017 by DK Hostmaster A/S
#
# Version: 2.0.2
#
# The data in the DK Whois database is provided by DK Hostmaster A/S
# for information purposes only, and to assist persons in obtaining
# information about or related to a domain name registration record.
# We do not guarantee its accuracy. We will reserve the right to remove
# access for entities abusing the data, without notice.
#
# Any use of this material to target advertising or similar activities
# are explicitly forbidden and will be prosecuted. DK Hostmaster A/S
# requests to be notified of any such activities or suspicions thereof.
Domain: danskebank.dk
DNS: danskebank.dk
Registered: 1996-02-02
Expires: 2018-03-31
Registration period: 1 year
VID: no
Dnssec: Signed delegation
Status: Active
Nameservers
Hostname: ns1.p20.dynect.net
Hostname: ns2.p20.dynect.net
Hostname: ns3.p20.dynect.net
Hostname: ns4.p20.dynect.net
# Use option --show-handles to get handle information.
# Whois HELP for more help.
Who hosts Danskebank.dk?
Danskebank.dk is hosted by Den Danske Bank A/S in Midtjylland, Stavtrup, Denmark, 8220.
Danskebank.dk has an IP Address of 212.93.36.130 and a hostname of 212.93.36.130.
Danskebank.dk Web Server Information
| Hosted IP Address: | 212.93.36.130 |
| Hosted Hostname: | 212.93.36.130 |
| Service Provider: | Den Danske Bank A/S |
| Hosted Country: |  DK |
| Location Latitude: | 56.1312 |
| Location Longitude: | 10.1199 |
| Webserver Software: | unknown |
HTTP Header Analysis for Danskebank.dk
| Http-Version: | 1.1 |
| Status-Code: | 200 |
| Status: | 200 OK |
| Connection: | Keep-Alive |
| Expires: | Fri, 12 Jun 2015 00:29:50 GMT |
| Date: | Fri, 12 Jun 2015 00:05:44 GMT |
| Content-Type: | text/html; charset=utf-8 |
| Cache-Control: | private |
| Vary: | Accept-Encoding |
| SPRequestGuid: | 6ee373d2-27f7-4cbb-a856-87682cb26885 |
| X-SharePointHealthScore: | 0 |
| X-Powered-By: | ASP.NET |
| MicrosoftSharePointTeamServices: | 14.0.0.7149 |
| X-MS-InvokeApp: | 1; RequireReadOnly |
| Content-Encoding: | gzip |
| Transfer-Encoding: | chunked |
Need to find out who hosts Danskebank.dk?
Danskebank.dk Free SEO Report
Website Inpage Analysis for Danskebank.dk
| H1 Headings: | 0 | ||
| H2 Headings: | 0 | ||
| H3 Headings: | 0 | ||
| H4 Headings: | 0 | ||
| H5 Headings: | 0 | ||
| H6 Headings: | 0 | ||
| Total IFRAMEs: | 0 | ||
| Total Images: | 0 | ||
| Google Adsense: | Not Applicable | ||
| Google Analytics: | Not Applicable |
Keyword Cloud for Danskebank.dk
screeneller9helefra3medalle produktervedk248be boligfeedbackandreringletbankdocumentlocationhref privatsoegq inputenter70 123sygdompopupdisplay right 0popupdisplaycloserevealmodaldanske bankbookameetinggenericreceiptrevealmodalfullos paf645 708kortbliv kundelukvalutatilderring tilprivatsoegq inputrightelsedocumentlocationhref123 45610 17 08dineog0800popupdisplay rightinvesteringepension10 17ersep229cookies08vejbookl230s0 0forsikring0findkanjune7mobilepayreturn falsebarnifforeninger70 10familienblivimportantkundedanskering til osfunction datadit410siteshj230lp1boligdocumentlocationhref privatsoegq2left0varp229 vejprivatkeycodenetbankprivatsoegqoslogurlprissprafdelingfunction ifmediadu5til os70 10 17digdatatab2finanstilsynetlivfalseskalflyttealledinmderight 0jquerykontimedia screenreturnbookameetinggeneralreceiptrevealmodalfulldu skall230s merebankp70 20functionvi70 123 456support45 70 123d248dsfaldproduktervoresnetpostfind hj230lpiek248betopommobilbankjobhvadinputcolorgeolocation0pxl248nmere17 08amperhverv
Longtail Keyword Density for Danskebank.dk
| Keywords | Occurences |
|---|---|
| 70 123 456 | 4 |
| documentlocationhref privatsoegq input | 4 |
| ring til os | 4 |
| popupdisplay right 0 | 3 |
| 70 10 17 | 3 |
| 45 70 123 | 3 |
| 10 17 08 | 3 |
| l230s mere | 8 |
| til os | 6 |
| bliv kunde | 6 |
| danske bank | 6 |
| du skal | 5 |
| documentlocationhref privatsoegq | 4 |
| function data | 4 |
| return false | 4 |
| find hj230lp | 4 |
| privatsoegq input | 4 |
| 70 20 | 4 |
| ring til | 4 |
| alle produkter | 4 |
| 45 70 | 4 |
| 70 123 | 4 |
| 123 456 | 4 |
| right 0 | 3 |
| popupdisplay right | 3 |
| os p | 3 |
| media screen | 3 |
| 0 0 | 3 |
| 17 08 | 3 |
| p229 vej | 3 |
| k248be bolig | 3 |
| 70 10 | 3 |
| 10 17 | 3 |
| function if | 3 |
| til | 20 |
| var | 18 |
| if | 16 |
| og | 16 |
| 0 | 15 |
| alle | 15 |
| 1 | 14 |
| function | 13 |
| du | 13 |
| find | 13 |
| p | 12 |
| bolig | 12 |
| os | 12 |
| danske | 11 |
| mere | 10 |
| bank | 10 |
| kort | 9 |
| important | 9 |
| din | 9 |
| l230s | 8 |
| netbank | 8 |
| skal | 8 |
| bliv | 8 |
| eller | 8 |
| kunde | 8 |
| input | 8 |
| p229 | 7 |
| flytte | 7 |
| vi | 7 |
| popupdisplay | 6 |
| produkter | 6 |
| afdeling | 6 |
| documentlocationhref | 6 |
| url | 6 |
| return | 6 |
| se | 6 |
| false | 6 |
| tab2 | 5 |
| pension | 5 |
| top | 5 |
| dit | 5 |
| dig | 5 |
| hj230lp | 5 |
| mde | 5 |
| e | 5 |
| 2 | 4 |
| screen | 4 |
| media | 4 |
| jquery | 4 |
| 3 | 4 |
| 4 | 4 |
| 5 | 4 |
| close-reveal-modal | 4 |
| keycode | 4 |
| hvad | 4 |
| data | 4 |
| luk | 4 |
| 6 | 4 |
| er | 4 |
| 0px | 4 |
| privatsoegq | 4 |
| geolocation | 4 |
| 7 | 4 |
| barn | 4 |
| familien | 4 |
| sygdom | 4 |
| d248dsfald | 4 |
| amp | 4 |
| konti | 4 |
| 0800 | 4 |
| med | 4 |
| ved | 4 |
| kan | 4 |
| privat | 4 |
| erhverv | 4 |
| log | 4 |
| foreninger | 4 |
| june | 4 |
| job | 4 |
| book | 4 |
| 8 | 4 |
| 9 | 4 |
| support | 4 |
| ring | 4 |
| pris | 4 |
| ie | 3 |
| color | 3 |
| vores | 3 |
| finanstilsynet | 3 |
| liv | 3 |
| book-a-meeting-generic-receiptreveal-modalfull | 3 |
| sites | 3 |
| andre | 3 |
| hele | 3 |
| book-a-meeting-general-receiptreveal-modalfull | 3 |
| spr | 3 |
| l248n | 3 |
| left0 | 3 |
| cookies | 3 |
| right | 3 |
| 10 | 3 |
| vej | 3 |
| enter | 3 |
| feedback | 3 |
| k248be | 3 |
| mobilbank | 3 |
| forsikring | 3 |
| valuta | 3 |
| else | 3 |
| fra | 3 |
| 08 | 3 |
| letbank | 3 |
| investering | 3 |
| dine | 3 |
| netpost | 3 |
| mobilepay | 3 |
| om | 3 |
| der | 3 |
| af | 3 |
What are the nameservers for danskebank.dk?
Danskebank.dk Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns4.p20.dynect.net |  | 204.13.251.20 |  United States |
| ns3.p20.dynect.net | | 208.78.71.20 | United States |
| ns2.p20.dynect.net | | 204.13.250.20 | United States |
| ns1.p20.dynect.net | | 208.78.70.20 | United States |