Dash4it.co.uk Favicon Dash4it.co.uk

Dash4it.co.uk Website Thumbnail
Checking...
The Specialist Map and Travel Guide Store
Low trust score
 | 
Add a review Change category Claim this site
We are the number 1 map superstore and Ordnance Survey Specialist. Your one stop shop for maps, guides and atlases. We stock a full range of maps and guide books from publishers such as Ordnance Survey - including a full range of OS Explorer, OS Landranger and Active maps, as well as European and World maps from Michelin, IGN and Harvey.


Domain summary

Domain label
dash4it
Domain extension
co.uk
Domain registered:
22-Sep-2006
Domain updated:
11-Sep-2020
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is dash4it.co.uk ranked relative to other sites:

Percentage of visits to dash4it.co.uk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Dash4it.co.uk registered?
A: Dash4it.co.uk was registered 14 years, 4 days, 16 hours, 11 minutes, 18 seconds ago on Friday, September 22, 2006.
Q: When was the WHOIS for Dash4it.co.uk last updated?
A: The WHOIS entry was last updated 2 weeks, 1 day, 16 hours, 11 minutes, 18 seconds ago on Friday, September 11, 2020.
Q: What are Dash4it.co.uk's nameservers?
A: DNS for Dash4it.co.uk is provided by the following nameservers:
  • ns0.dnsmadeeasy.com
  • ns1.dnsmadeeasy.com
  • ns2.dnsmadeeasy.com
  • ns3.dnsmadeeasy.com
  • ns4.dnsmadeeasy.com
Q: Who is the registrar for the Dash4it.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Dash4it.co.uk?
A: Dash4it.co.uk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Dash4it.co.uk each day?
A: Dash4it.co.uk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Dash4it.co.uk resolve to?
A: Dash4it.co.uk resolves to the IPv4 address 78.129.161.99.
Q: In what country are Dash4it.co.uk servers located in?
A: Dash4it.co.uk has servers located in the United Kingdom.
Q: What webserver software does Dash4it.co.uk use?
A: Dash4it.co.uk is powered by Nginx webserver.
Q: Who hosts Dash4it.co.uk?
A: Dash4it.co.uk is hosted by Iomart in United Kingdom.
Q: How much is Dash4it.co.uk worth?
A: Dash4it.co.uk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Dash4it.co.uk?

Dash4it.co.uk Hosting Provider Information

Hosted IP Address:78.129.161.99
Hosted Hostname:78.129.161.99
Service Provider:Iomart
Hosted Country:United KingdomGB
Location Latitude:51.4964
Location Longitude:-0.1224
Webserver Software:nginx

Is "Iomart" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Dash4it.co.uk

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx
Date: Fri, 11 Sep 2020 22:15:53 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
Location: https://dash4it.co.uk/

Dash4it.co.uk Domain Nameserver Information

HostIP AddressCountry
ns0.dnsmadeeasy.com 208.94.148.2
ns1.dnsmadeeasy.com 208.80.124.2
ns2.dnsmadeeasy.com 208.80.126.2
ns3.dnsmadeeasy.com 208.80.125.2
ns4.dnsmadeeasy.com 208.80.127.2


Need to find out who hosts Dash4it.co.uk?


WhoIs information for Dash4it.co.uk

 Domain name:
dash4it.co.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 11-Sep-2019

Registrar:
Fasthosts Internet Ltd [Tag = LIVEDOMAINS]
URL: http://www.fasthosts.co.uk

Relevant dates:
Registered on: 22-Sep-2006
Expiry date: 22-Sep-2020
Last updated: 11-Sep-2019

Registration status:
Registered until expiry date.

Name servers:
ns0.dnsmadeeasy.com
ns1.dnsmadeeasy.com
ns2.dnsmadeeasy.com
ns3.dnsmadeeasy.com
ns4.dnsmadeeasy.com

WHOIS lookup made at 03:02:45 09-Jul-2020

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2020.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Dash4it.co.uk Free SEO Report

Website Inpage Analysis for Dash4it.co.uk

H1 Headings

1 :
  1. Welcome to Dash4it.co.uk the UK’s leading map and guide superstore, where exceptional service and prices meet.

H2 Headings

1 :
  1. DWN Ltd

H3 Headings

5 :
  1. Map Finder
  2. FREE UK DELIVERY ON ALL ORDERS
  3. Customer Service
  4. Company Info
  5. Advice & Resources

H4 Headings

4 :
  1. To find your OS map, use our new Map Search tool below.
  2. We stock a huge range of maps, atlases and travel guides for the UK and around the world. Our aim is to offer the best possible prices on all of our maps and guides, not just with occasional offers but with our permanently low prices. In fact, we are so confident of our prices that we offer a price match guarantee on our maps. This coupled with our focus on customer service and satisfaction means that the service you receive is second to none and with free delivery on all orders, there’s no wonder that we are the map superstore of choice.
  3. VAT No: GB 123 3905 38Company Registration No: 7909282 England & Wales
  4. Copyright © DWN LtdDash4It is a division of DWN Ltd and part of The Dash Group

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

37 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

463:
  1. here
    https://dash4it.co.uk/?PageSpeed=noscript
  2. My Account
    https://dash4it.co.uk/customer/account/
  3. Sign In
    https://dash4it.co.uk/customer/account/login/
  4. Fast Order
    https://dash4it.co.uk/fast-order/
  5. Live Chat
    https://dash4it.co.uk/
  6. national
    https://dash4it.co.uk/catalogsearch/result/?q=national
  7. os 303
    https://dash4it.co.uk/catalogsearch/result/?q=os+303
  8. brecon beacons
    https://dash4it.co.uk/catalogsearch/result/?q=brecon+beacons
  9. park
    https://dash4it.co.uk/catalogsearch/result/?q=park
  10. departmental
    https://dash4it.co.uk/catalogsearch/result/?q=departmental
  11. The
    https://dash4it.co.uk/catalogsearch/result/?q=The
  12. department
    https://dash4it.co.uk/catalogsearch/result/?q=department
  13. europe
    https://dash4it.co.uk/catalogsearch/result/?q=europe
  14. europes
    https://dash4it.co.uk/catalogsearch/result/?q=europes
  15. spey
    https://dash4it.co.uk/catalogsearch/result/?q=spey
  16. Your
    https://dash4it.co.uk/catalogsearch/result/?q=Your
  17. admin
    https://dash4it.co.uk/catalogsearch/result/?q=admin
  18. active
    https://dash4it.co.uk/catalogsearch/result/?q=active
  19. 303
    https://dash4it.co.uk/catalogsearch/result/?q=303
  20. 1
    https://dash4it.co.uk/catalogsearch/result/?q=1
  21. south west coast path
    https://dash4it.co.uk/catalogsearch/result/?q=south+west+coast+path
  22. south west coast
    https://dash4it.co.uk/catalogsearch/result/?q=south+west+coast
  23. south west coa
    https://dash4it.co.uk/catalogsearch/result/?q=south+west+coa
  24. south west
    https://dash4it.co.uk/catalogsearch/result/?q=south+west
  25. Ordnance Survey
    https://dash4it.co.uk/ordnance-survey-maps.html
  26. No text
    https://dash4it.co.uk/ordnance-survey-maps.html
  27. OS Map & Guide Series
    https://dash4it.co.uk/ordnance-survey-maps./series.html
  28. OS Explorer Maps
    https://dash4it.co.uk/ordnance-survey-maps/series./explorer.html
  29. OS Explorer Active Maps (Laminated)
    https://dash4it.co.uk/ordnance-survey-maps/series./explorer-active-laminated.html
  30. OS Landranger Maps
    https://dash4it.co.uk/ordnance-survey-maps/series./landranger.html
  31. OS Landranger Active Maps (Laminated)
    https://dash4it.co.uk/ordnance-survey-maps/series./landranger-active-laminated.html
  32. OS Road Maps
    https://dash4it.co.uk/ordnance-survey-maps/series./os-road-maps.html
  33. OS Tour Maps
    https://dash4it.co.uk/ordnance-survey-maps/series./tour.html
  34. OS Discoverer Maps (Northern Ireland)
    https://dash4it.co.uk/ordnance-survey-maps/series./discoverer-ni.html
  35. OS Discovery Maps (ROI)
    https://dash4it.co.uk/ordnance-survey-maps/series./discovery-roi.html
  36. OS Ireland Tour Maps (1:250k)
    https://dash4it.co.uk/ordnance-survey-maps/series./ireland-tour-1-250k.html
  37. OS N.Ireland Activity Maps
    https://dash4it.co.uk/ordnance-survey-maps/series./ireland-activity.html
  38. OS Dublin City Maps
    https://dash4it.co.uk/ordnance-survey-maps/series./os-dublin-city-maps.html
  39. OS Planning Maps
    https://dash4it.co.uk/ordnance-survey-maps/series./planning-maps.html
  40. OS Admin Boundary Maps
    https://dash4it.co.uk/ordnance-survey-maps/series./boundary-maps.html
  41. OS Historical Maps
    https://dash4it.co.uk/ordnance-survey-maps/series./historical-maps.html
  42. Channel Island Maps
    https://dash4it.co.uk/ordnance-survey-maps/series./channel-island-maps.html
  43. OS Digital Subscription
    https://dash4it.co.uk/ordnance-survey-maps./series/os-digital-subscription.html
  44. Urban Walks
    https://dash4it.co.uk/ordnance-survey-maps./series/urban-walks.html
  45. OS Wall Maps
    https://dash4it.co.uk/ordnance-survey-maps./series/os-wall-maps.html
  46. OS Pathfinder Guides
    https://dash4it.co.uk/ordnance-survey-maps./series/os-pathfinder-guides.html
  47. OS Short Walk Guides
    https://dash4it.co.uk/ordnance-survey-maps./series/os-short-walk-guides.html
  48. Activity
    https://dash4it.co.uk/ordnance-survey-maps./activity.html
  49. Maps for Walking
    https://dash4it.co.uk/ordnance-survey-maps/activity./walking.html
  50. Maps for Cycling
    https://dash4it.co.uk/ordnance-survey-maps/activity./cycling.html
  51. Maps for Horse Riding
    https://dash4it.co.uk/ordnance-survey-maps/activity./horse-riding.html
  52. Maps for Touring
    https://dash4it.co.uk/ordnance-survey-maps/activity./touring.html
  53. Maps for Orienteering
    https://dash4it.co.uk/ordnance-survey-maps/activity./orienteering.html
  54. Maps for Driving
    https://dash4it.co.uk/ordnance-survey-maps/activity./driving.html
  55. Collect & Scratch Maps
    https://dash4it.co.uk/ordnance-survey-maps./activity/collect-scratch-maps.html
  56. Globes
    https://dash4it.co.uk/ordnance-survey-maps./activity/globes.html
  57. Site Plan Maps
    https://dash4it.co.uk/ordnance-survey-maps./activity/site-plan-maps.html
  58. OS Map Sets & Challenges
    https://dash4it.co.uk/ordnance-survey-maps./map-sets-bundles.html
  59. National Parks
    https://dash4it.co.uk/ordnance-survey-maps/map-sets-bundles./national-parks.html
  60. National Trails
    https://dash4it.co.uk/ordnance-survey-maps/map-sets-bundles./national-trails.html
  61. Challenges
    https://dash4it.co.uk/ordnance-survey-maps/map-sets-bundles./challenges.html
  62. Full Sets
    https://dash4it.co.uk/ordnance-survey-maps/map-sets-bundles./full-sets.html
  63. Country
    https://dash4it.co.uk/ordnance-survey-maps./country.html
  64. OS Maps - England
    https://dash4it.co.uk/ordnance-survey-maps/country./england.html
  65. OS Maps - Scotland
    https://dash4it.co.uk/ordnance-survey-maps/country./scotland.html
  66. OS Maps - Wales
    https://dash4it.co.uk/ordnance-survey-maps/country./wales.html
  67. OS Maps - Northern Ireland
    https://dash4it.co.uk/ordnance-survey-maps/country./northern-ireland.html
  68. OS Maps - Republic Of Ireland
    https://dash4it.co.uk/ordnance-survey-maps/country./republic-of-ireland.html
  69. Maps & Atlases
    https://dash4it.co.uk/uk-maps-39.html
  70. No text
    https://dash4it.co.uk/maps-landing-blocks.html
  71. Publisher/Brand
    https://dash4it.co.uk/uk-maps./publisher-brand.html
  72. AA Maps & Atlases
    https://dash4it.co.uk/uk-maps/publisher-brand./theaa.html
  73. A-Z Maps & Atlases
    https://dash4it.co.uk/uk-maps/publisher-brand./a-z.html
  74. Borch City Maps
    https://dash4it.co.uk/uk-maps./publisher-brand/borch-city-maps.html
  75. Cassini Historical Maps
    https://dash4it.co.uk/uk-maps/publisher-brand./cassini.html
  76. CNIG - (Spanish Department Maps)
    https://dash4it.co.uk/uk-maps./publisher-brand/cnig-spanish-department-maps.html
  77. Ferdakort (Iceland Regional) Maps
    https://dash4it.co.uk/uk-maps./publisher-brand/ferdakort-iceland-regional-maps.html
  78. Footprint Maps
    https://dash4it.co.uk/uk-maps/publisher-brand./footprint-maps.html
  79. Freytag & Berndt Maps
    https://dash4it.co.uk/uk-maps./publisher-brand/freytag-berndt-maps.html
  80. Harper Collins
    https://dash4it.co.uk/uk-maps/publisher-brand./harper-collins.html
  81. Harvey Maps
    https://dash4it.co.uk/uk-maps/publisher-brand./harvey.html
  82. Heron Waterway Maps
    https://dash4it.co.uk/uk-maps/publisher-brand./heron-waterway-maps.html
  83. IGN Maps
    https://dash4it.co.uk/uk-maps./publisher-brand/ign-institut-geographique-national-fr.html
  84. IGN 1:25K - Blue Maps
    https://dash4it.co.uk/uk-maps./publisher-brand/ign-institut-geographique-national-fr/ign-1-25k-blue-maps.html
  85. IGN 1:75K - National Park Maps
    https://dash4it.co.uk/uk-maps./publisher-brand/ign-institut-geographique-national-fr/ign-top-75-national-park.html
  86. IGN 1:100K - Local Maps
    https://dash4it.co.uk/uk-maps./publisher-brand/ign-institut-geographique-national-fr/top-100-1-100k.html
  87. IGN 1:150K - Departmental Maps
    https://dash4it.co.uk/uk-maps./publisher-brand/ign-institut-geographique-national-fr/departments.html
  88. IGN 1:250K - Regional Maps
    https://dash4it.co.uk/uk-maps./publisher-brand/ign-institut-geographique-national-fr/regional.html
  89. Discovery of France Maps
    https://dash4it.co.uk/uk-maps./publisher-brand/ign-institut-geographique-national-fr/discovery-of-france-maps.html
  90. Kompass Maps
    https://dash4it.co.uk/uk-maps./publisher-brand/kompass-maps.html
  91. Lonely Planet Maps
    https://dash4it.co.uk/uk-maps./publisher-brand/lonely-planet-maps.html
  92. ITMB
    https://dash4it.co.uk/uk-maps/publisher-brand./itmb.html
  93. Marco Polo
    https://dash4it.co.uk/uk-maps./publisher-brand/marco-polo.html
  94. Michelin Maps
    https://dash4it.co.uk/uk-maps/publisher-brand./michelin.html
  95. National Geographic Maps
    https://dash4it.co.uk/uk-maps./publisher-brand/national-geographic-maps.html
  96. Ordnance Survey Maps
    https://dash4it.co.uk/uk-maps/publisher-brand./ordnance-survey.html
  97. Philips Maps & Atlases
    https://dash4it.co.uk/uk-maps/publisher-brand./philips.html
  98. Popout Maps
    https://dash4it.co.uk/uk-maps/publisher-brand./popout.html
  99. Rando Maps
    https://dash4it.co.uk/uk-maps./publisher-brand/ign-randonnee-mountains.html
  100. Red Book Street Atlases
    https://dash4it.co.uk/uk-maps/publisher-brand./red-books.html
  101. Sustrans NCN Maps
    https://dash4it.co.uk/uk-maps/publisher-brand./sustrans-ncn.html
  102. ST&G Marvellous Maps
    https://dash4it.co.uk/uk-maps/publisher-brand./st-g-marvellous-maps.html
  103. TCI Maps
    https://dash4it.co.uk/uk-maps./publisher-brand/tci.html
  104. The Little Map Company
    https://dash4it.co.uk/uk-maps/publisher-brand./the-little-map-company.html
  105. Trans Pennine Trail Maps
    https://dash4it.co.uk/uk-maps/publisher-brand./trans-pennine-trail-maps.html
  106. Activity
    https://dash4it.co.uk/uk-maps./activities.html
  107. Maps for Walking
    https://dash4it.co.uk/uk-maps/activities./walking.html
  108. Maps for Cycling
    https://dash4it.co.uk/uk-maps/activities./cycling.html
  109. Maps for Horse Riding
    https://dash4it.co.uk/uk-maps/activities./horse-riding.html
  110. Maps for Touring
    https://dash4it.co.uk/uk-maps/activities./touring.html
  111. Maps for Travelling
    https://dash4it.co.uk/uk-maps./activities/travelling.html
  112. Maps for Geocaching
    https://dash4it.co.uk/uk-maps/activities./geocaching.html
  113. Maps for Orienteering
    https://dash4it.co.uk/uk-maps/activities./orienteering.html
  114. Maps for Driving
    https://dash4it.co.uk/uk-maps/activities./driving.html
  115. Map of Canals/Waterways
    https://dash4it.co.uk/uk-maps/activities./map-of-canals-waterways.html
  116. Reference Maps
    https://dash4it.co.uk/uk-maps./activities/reference-maps.html
  117. Map Sets & Challenges
    https://dash4it.co.uk/uk-maps./map-sets-bundles.html
  118. National Parks
    https://dash4it.co.uk/uk-maps/map-sets-bundles./national-parks.html
  119. National Trails
    https://dash4it.co.uk/uk-maps/map-sets-bundles./national-trails.html
  120. Challenges
    https://dash4it.co.uk/uk-maps/map-sets-bundles./challenges.html
  121. Full Map Sets
    https://dash4it.co.uk/uk-maps/map-sets-bundles./full-map-sets.html
  122. Product Format
    https://dash4it.co.uk/uk-maps./product-format.html
  123. Standard Maps
    https://dash4it.co.uk/uk-maps/product-format./standard-maps.html
  124. Street View Atlas
    https://dash4it.co.uk/uk-maps/product-format./street-view-atlas.html
  125. Road Atlas
    https://dash4it.co.uk/uk-maps/product-format./road-atlas-country-region.html
  126. Digital Maps
    https://dash4it.co.uk/uk-maps/product-format./digital-maps.html
  127. Customised Maps
    https://dash4it.co.uk/uk-maps/product-format./customised-maps.html
  128. Wall Maps and POD Maps
    https://dash4it.co.uk/uk-maps./product-format/wall-maps-and-pod-maps.html
  129. Reference
    https://dash4it.co.uk/uk-maps./product-format/wall-maps-and-pod-maps/reference.html
  130. Continents
    https://dash4it.co.uk/uk-maps./product-format/wall-maps-and-pod-maps/reference/continents.html
  131. Countries
    https://dash4it.co.uk/uk-maps./product-format/wall-maps-and-pod-maps/reference/countries.html
  132. Cities & Regions
    https://dash4it.co.uk/uk-maps./product-format/wall-maps-and-pod-maps/reference/cities-regions.html
  133. World
    https://dash4it.co.uk/uk-maps./product-format/wall-maps-and-pod-maps/reference/world.html
  134. Oceans & Poles
    https://dash4it.co.uk/uk-maps./product-format/wall-maps-and-pod-maps/reference/oceans-poles.html
  135. Space
    https://dash4it.co.uk/uk-maps./product-format/wall-maps-and-pod-maps/reference/space.html
  136. History & Discovery
    https://dash4it.co.uk/uk-maps./product-format/wall-maps-and-pod-maps/historical.html
  137. Continents
    https://dash4it.co.uk/uk-maps./product-format/wall-maps-and-pod-maps/historical/continents.html
  138. Countries
    https://dash4it.co.uk/uk-maps./product-format/wall-maps-and-pod-maps/historical/countries.html
  139. World
    https://dash4it.co.uk/uk-maps./product-format/wall-maps-and-pod-maps/historical/world.html
  140. Cities & Regions
    https://dash4it.co.uk/uk-maps./product-format/wall-maps-and-pod-maps/historical/cities-regions.html
  141. Oceans & Poles
    https://dash4it.co.uk/uk-maps./product-format/wall-maps-and-pod-maps/historical/oceans-poles.html
  142. Space
    https://dash4it.co.uk/uk-maps./product-format/wall-maps-and-pod-maps/historical/space.html
  143. Planning Maps
    https://dash4it.co.uk/uk-maps./product-format/planning-maps.html
  144. Continent/Country
    https://dash4it.co.uk/uk-maps./country.html
  145. Maps of Africa
    https://dash4it.co.uk/uk-maps./country/africa.html
  146. Maps of Asia
    https://dash4it.co.uk/uk-maps./country/asia.html
  147. Maps of North America
    https://dash4it.co.uk/uk-maps./country/north-america.html
  148. Maps of South America
    https://dash4it.co.uk/uk-maps./country/south-america.html
  149. Eastern Europe
    https://dash4it.co.uk/uk-maps./country/eastern-europe.html
  150. Albania
    https://dash4it.co.uk/uk-maps./country/eastern-europe/albania.html
  151. Armenia
    https://dash4it.co.uk/uk-maps./country/eastern-europe/armenia.html
  152. Azerbaijan
    https://dash4it.co.uk/uk-maps./country/eastern-europe/azerbaijan.html
  153. Bosnia & Herzegovina
    https://dash4it.co.uk/uk-maps./country/eastern-europe/bosnia-herzegovina.html
  154. Belarus
    https://dash4it.co.uk/uk-maps./country/eastern-europe/belarus.html
  155. Bulgaria
    https://dash4it.co.uk/uk-maps./country/eastern-europe/bulgaria.html
  156. Croatia
    https://dash4it.co.uk/uk-maps./country/eastern-europe/croatia.html
  157. Cyprus
    https://dash4it.co.uk/uk-maps./country/eastern-europe/cyprus.html
  158. Czech Republic
    https://dash4it.co.uk/uk-maps./country/eastern-europe/czech-republic.html
  159. Estonia
    https://dash4it.co.uk/uk-maps./country/eastern-europe/estonia.html
  160. Georgia
    https://dash4it.co.uk/uk-maps./country/eastern-europe/georgia.html
  161. Hungary
    https://dash4it.co.uk/uk-maps./country/eastern-europe/hungary.html
  162. Kazakhstan
    https://dash4it.co.uk/uk-maps./country/eastern-europe/kazakhstan.html
  163. Latvia
    https://dash4it.co.uk/uk-maps./country/eastern-europe/latvia.html
  164. Lithuania
    https://dash4it.co.uk/uk-maps./country/eastern-europe/lithuania.html
  165. Malta
    https://dash4it.co.uk/uk-maps./country/eastern-europe/malta.html
  166. Moldova
    https://dash4it.co.uk/uk-maps./country/eastern-europe/moldova.html
  167. Montenegro
    https://dash4it.co.uk/uk-maps./country/eastern-europe/montenegro.html
  168. Poland
    https://dash4it.co.uk/uk-maps./country/eastern-europe/poland.html
  169. Romania
    https://dash4it.co.uk/uk-maps./country/eastern-europe/romania.html
  170. Russia
    https://dash4it.co.uk/uk-maps./country/eastern-europe/russia.html
  171. Slovakia
    https://dash4it.co.uk/uk-maps./country/eastern-europe/slovakia.html
  172. Slovenia
    https://dash4it.co.uk/uk-maps./country/eastern-europe/slovenia.html
  173. Turkey
    https://dash4it.co.uk/uk-maps./country/eastern-europe/turkey.html
  174. Ukraine
    https://dash4it.co.uk/uk-maps./country/eastern-europe/ukraine.html
  175. Western Europe
    https://dash4it.co.uk/uk-maps./country/european-countries.html
  176. Andorra
    https://dash4it.co.uk/uk-maps./country/european-countries/andorra.html
  177. Austria
    https://dash4it.co.uk/uk-maps./country/european-countries/austria.html
  178. Belgium
    https://dash4it.co.uk/uk-maps./country/european-countries/belgium.html
  179. Denmark
    https://dash4it.co.uk/uk-maps./country/european-countries/denmark.html
  180. Finland
    https://dash4it.co.uk/uk-maps./country/european-countries/finland.html
  181. France
    https://dash4it.co.uk/uk-maps./country/european-countries/france.html
  182. Germany
    https://dash4it.co.uk/uk-maps./country/european-countries/germany.html
  183. Gibraltar
    https://dash4it.co.uk/uk-maps./country/european-countries/gibraltar.html
  184. Greece
    https://dash4it.co.uk/uk-maps./country/european-countries/greece.html
  185. Iceland
    https://dash4it.co.uk/uk-maps./country/european-countries/iceland.html
  186. Ireland
    https://dash4it.co.uk/uk-maps./country/european-countries/ireland.html
  187. Italy
    https://dash4it.co.uk/uk-maps./country/european-countries/italy.html
  188. Liechtenstein
    https://dash4it.co.uk/uk-maps./country/european-countries/liechtenstein.html
  189. Luxembourg
    https://dash4it.co.uk/uk-maps./country/european-countries/luxembourg.html
  190. Monaco
    https://dash4it.co.uk/uk-maps./country/european-countries/monaco.html
  191. Netherlands
    https://dash4it.co.uk/uk-maps./country/european-countries/netherlands.html
  192. Norway
    https://dash4it.co.uk/uk-maps./country/european-countries/norway.html
  193. Portugal
    https://dash4it.co.uk/uk-maps./country/european-countries/portugal.html
  194. Spain
    https://dash4it.co.uk/uk-maps./country/european-countries/spain.html
  195. Sweden
    https://dash4it.co.uk/uk-maps./country/european-countries/sweden.html
  196. Switzerland
    https://dash4it.co.uk/uk-maps./country/european-countries/switzerland.html
  197. Maps of Oceania
    https://dash4it.co.uk/uk-maps./country/oceania.html
  198. Worldwide Maps
    https://dash4it.co.uk/uk-maps./country/worldwide.html
  199. UK Maps
    https://dash4it.co.uk/uk-maps./country/uk-maps.html
  200. England
    https://dash4it.co.uk/uk-maps/country./england.html
  201. Scotland
    https://dash4it.co.uk/uk-maps/country./scotland.html
  202. Wales
    https://dash4it.co.uk/uk-maps/country./wales.html
  203. Northern Ireland
    https://dash4it.co.uk/uk-maps/country./northern-ireland.html
  204. Historical
    https://dash4it.co.uk/uk-maps./historical.html
  205. OS Ancient & Roman Britain Maps
    https://dash4it.co.uk/uk-maps/historical./ancient-roman-britain.html
  206. All WWI & WWII Maps
    https://dash4it.co.uk/uk-maps./historical/all-ww1-and-ww2.html
  207. WWI Maps
    https://dash4it.co.uk/uk-maps./historical/ww1-maps.html
  208. WWII Maps
    https://dash4it.co.uk/uk-maps./historical/ww2-maps.html
  209. Great War Centenary Maps
    https://dash4it.co.uk/uk-maps./historical/great-war-centenary-maps.html
  210. Cassini Old Series Maps (1816 - 1836)
    https://dash4it.co.uk/uk-maps/historical./old-series-1816-1836.html
  211. Cassini Revised New Maps (1878 - 1912)
    https://dash4it.co.uk/uk-maps/historical./revised-new-series-1878-1912.html
  212. Cassini Popular Edition Maps (1914 - 1938)
    https://dash4it.co.uk/uk-maps/historical./popular-edition-1914-1938.html
  213. Cassini Past & Present Maps (1816 - 1938)
    https://dash4it.co.uk/uk-maps/historical./past-present-1816-1938.html
  214. Cassini 3 Map Box Sets
    https://dash4it.co.uk/uk-maps/historical./box-sets.html
  215. Cassini 5 Map Box Sets
    https://dash4it.co.uk/uk-maps/historical./5-map-box-sets.html
  216. Customised Historical Maps
    https://dash4it.co.uk/uk-maps/historical./customised-historical-maps.html
  217. No text
    https://dash4it.co.uk/price-match-policy-page
  218. Guide Books
    https://dash4it.co.uk/walking-guide-books/walking-and-travel-guides.html
  219. No text
    https://dash4it.co.uk/guide-books-42.html
  220. Walking Guides
    https://dash4it.co.uk/guide-books-42/publisher-brand.html
  221. Ordnance Survey
    https://dash4it.co.uk/guide-books-42/publisher-brand/os-crimson.html
  222. Cicerone
    https://dash4it.co.uk/guide-books-42/publisher-brand/cicerone.html
  223. Collins
    https://dash4it.co.uk/guide-books-42/publisher-brand/collins.html
  224. The AA
    https://dash4it.co.uk/guide-books-42/publisher-brand/aa.html
  225. Walking Books
    https://dash4it.co.uk/guide-books-42/publisher-brand/walking-books.html
  226. Challenge Publications
    https://dash4it.co.uk/guide-books-42/publisher-brand/challenge-publications.html
  227. Trailblazer
    https://dash4it.co.uk/guide-books-42/publisher-brand/trailblazer.html
  228. Alistair Sawday
    https://dash4it.co.uk/guide-books-42/publisher-brand/alistair-sawday.html
  229. DK Guides
    https://dash4it.co.uk/walking-guide-books/publisher-brand/dk-guides.html
  230. Travel Guides
    https://dash4it.co.uk/walking-guide-books/publisher-brand.html
  231. Lonely Planet Guides
    https://dash4it.co.uk/walking-guide-books/publisher-brand/lonely-planet-guides.html
  232. Michelin Guides
    https://dash4it.co.uk/walking-guide-books/publisher-brand/michelin-guides.html
  233. DK Eyewitness & Rough Guides
    https://dash4it.co.uk/walking-guide-books/publisher-brand/dk.html
  234. Footprint Guides
    https://dash4it.co.uk/walking-guide-books/publisher-brand/footprint-guides.html
  235. Sunflower Guides
    https://dash4it.co.uk/walking-guide-books/publisher-brand/sunflower-guides.html
  236. Wild/Punk Guides
    https://dash4it.co.uk/walking-guide-books/publisher-brand/wild-punk-guides.html
  237. Marco Polo Guides
    https://dash4it.co.uk/walking-guide-books/publisher-brand/marco-polo.html
  238. Camperstop Motorhome Guide
    https://dash4it.co.uk/walking-guide-books/publisher-brand/camperstop-acsi.html
  239. Guides By Interest
    https://dash4it.co.uk/walking-guide-books.html
  240. General Holiday & Travel
    https://dash4it.co.uk/walking-guide-books/activity/general-holiday-travel.html
  241. Caravan & Camping Guides
    https://dash4it.co.uk/walking-guide-books/activity/camping-and-caravaning.html
  242. City Guides
    https://dash4it.co.uk/walking-guide-books/activity/city-breaks.html
  243. Backpacking & World Travel
    https://dash4it.co.uk/walking-guide-books/activity/backpacking-world-travel.html
  244. Language & Culture
    https://dash4it.co.uk/walking-guide-books/activity/language-culture.html
  245. Skills & Techniques
    https://dash4it.co.uk/walking-guide-books/activity/skills-and-techniques.html
  246. Eating Out
    https://dash4it.co.uk/walking-guide-books/activity/eating-out.html
  247. Wildlife
    https://dash4it.co.uk/walking-guide-books/activity/wildlife.html
  248. Historical Guides
    https://dash4it.co.uk/walking-guide-books/activity/historical-guides.html
  249. Puzzles & Fun
    https://dash4it.co.uk/walking-guide-books/activity/puzzles-fun.html
  250. Gen. Reading & Biographies
    https://dash4it.co.uk/walking-guide-books/activity/general-reading.html
  251. International Dining
    https://dash4it.co.uk/walking-guide-books/activity/international-dining.html
  252. Continent
    https://dash4it.co.uk/walking-guide-books/walking-and-travel-guides.html
  253. Europe
    https://dash4it.co.uk/walking-guide-books/walking-and-travel-guides/europe.html
  254. Africa
    https://dash4it.co.uk/walking-guide-books/walking-and-travel-guides/africa.html
  255. Asia
    https://dash4it.co.uk/walking-guide-books/walking-and-travel-guides/asia.html
  256. North America
    https://dash4it.co.uk/walking-guide-books/walking-and-travel-guides/north-america.html
  257. South America
    https://dash4it.co.uk/walking-guide-books/walking-and-travel-guides/south-america.html
  258. Oceania
    https://dash4it.co.uk/walking-guide-books/walking-and-travel-guides/oceania.html
  259. Nautical Charts
    https://dash4it.co.uk/charts-43.html
  260. No text
    https://dash4it.co.uk/charts-43.html
  261. Publisher/Brand
    https://dash4it.co.uk/charts./admiralty.html
  262. Admiralty Charts
    https://dash4it.co.uk/charts/admiralty./admiralty.html
  263. Imray Charts
    https://dash4it.co.uk/charts/admiralty./imray.html
  264. Reeds Almanacs
    https://dash4it.co.uk/charts/admiralty./reeds-almanacs.html
  265. Pilot Guides
    https://dash4it.co.uk/charts/admiralty./pilot-guides.html
  266. Heron Waterway Maps
    https://dash4it.co.uk/charts/admiralty./heron-waterway-maps.html
  267. Collins Waterways Guides
    https://dash4it.co.uk/charts/admiralty./collins-waterways-guides.html
  268. Chart Series
    https://dash4it.co.uk/charts./chart-series.html
  269. Imray A' Caribbean
    https://dash4it.co.uk/charts/chart-series./a-caribbean.html
  270. Imray B' Caribbean
    https://dash4it.co.uk/charts/chart-series./b-caribbean.html
  271. Imray C' UK - Coastal
    https://dash4it.co.uk/charts/chart-series./c-uk.html
  272. Imray D' Caribbean
    https://dash4it.co.uk/charts/chart-series./d-caribbean.html
  273. Imray E' Atlantic Islands
    https://dash4it.co.uk/charts/chart-series./e-atlantic-islands.html
  274. Imray G' Mediterranean
    https://dash4it.co.uk/charts/chart-series./g-mediterranean.html
  275. Imray M' Mediterranean
    https://dash4it.co.uk/charts/chart-series./imray-m-mediterranean.html
  276. Imray Y' UK - Inland Rivers & Estuaries
    https://dash4it.co.uk/charts/chart-series./y-uk-inland-rivers-estuaries.html
  277. Imray 2000 Series Chart Packs
    https://dash4it.co.uk/charts/chart-series./imray-2000-series-chart-packs.html
  278. Admiralty Leisure Folio Packs
    https://dash4it.co.uk/charts/chart-series./admiralty-leisure-folio-packs.html
  279. Digital Charts
    https://dash4it.co.uk/charts/chart-series./digital-charts.html
  280. Waterways Maps
    https://dash4it.co.uk/charts/chart-series./waterways-maps.html
  281. Waterways Guides
    https://dash4it.co.uk/charts/chart-series./waterways-guides-1010.html
  282. Continent
    https://dash4it.co.uk/charts./continent.html
  283. Charts for Africa
    https://dash4it.co.uk/charts/continent./africa.html
  284. Charts for Asia
    https://dash4it.co.uk/charts/continent./asia.html
  285. Charts for Europe
    https://dash4it.co.uk/charts/continent./europe.html
  286. Charts for North America
    https://dash4it.co.uk/charts/continent./north-america.html
  287. Charts for South America
    https://dash4it.co.uk/charts/continent./south-america.html
  288. Charts for Oceania
    https://dash4it.co.uk/charts/continent./oceania.html
  289. Chart Accessories
    https://dash4it.co.uk/charts./chart-guides-and-accessories.html
  290. Almanacs
    https://dash4it.co.uk/charts/chart-guides-and-accessories./almanacs.html
  291. Marine Accessories
    https://dash4it.co.uk/charts/chart-guides-and-accessories./plotters-dividers.html
  292. Technique Manuals & Guides
    https://dash4it.co.uk/charts/chart-guides-and-accessories./technique-manuals-guides.html
  293. Pilot Books & Guides
    https://dash4it.co.uk/charts/chart-guides-and-accessories./pilot-guides.html
  294. Custom Maps
    https://dash4it.co.uk/custom-map.html
  295. No text
    https://dash4it.co.uk/map-creator/recreation/topographic-mapping.html
  296. No text
    https://dash4it.co.uk/site-plan-map.html
  297. Outdoor Recreation
    https://dash4it.co.uk/custom-map/recreation.html
  298. Topographic Maps
    https://dash4it.co.uk/custom-map/recreation/topographic-mapping.html
  299. Relief Maps
    https://dash4it.co.uk/custom-map/recreation/topographic-maps.html
  300. Fixed Scale OS Mapping (1:25k,1:50k...)
    https://dash4it.co.uk/custom-map/recreation/fixed-scale-os-mapping-1-25k-1-50k.html
  301. Variable Scale OS Mapping
    https://dash4it.co.uk/custom-map/recreation/variable-scale-os-mapping.html
  302. UK Planning & Build Maps
    https://dash4it.co.uk/site-plan-map.html
  303. 1:200 Scale Block Plans
    https://dash4it.co.uk/site-plan-map.html
  304. 1:500 Scale Block Plans
    https://dash4it.co.uk/site-plan-map.html
  305. 1:1250 Scale Site Plans
    https://dash4it.co.uk/site-plan-map.html
  306. 1:2500 Scale Site Plans
    https://dash4it.co.uk/site-plan-map.html
  307. Business & Planning
    https://dash4it.co.uk/custom-map/business.html
  308. Street Maps
    https://dash4it.co.uk/custom-map/business/street-maps.html
  309. Regional Maps
    https://dash4it.co.uk/custom-map/business/regional-maps.html
  310. Administrative Boundary Maps
    https://dash4it.co.uk/custom-map/business/administrative-boundary-maps.html
  311. UK Planning & Build Maps
    https://dash4it.co.uk/custom-map/business/os-planning-build-maps.html
  312. Travel & Road
    https://dash4it.co.uk/custom-map/travel.html
  313. Topographic Maps
    https://dash4it.co.uk/custom-map/travel/topographic-maps.html
  314. Street Maps
    https://dash4it.co.uk/custom-map/travel/street-maps.html
  315. Road Maps
    https://dash4it.co.uk/custom-map/travel/road-maps.html
  316. Regional Maps
    https://dash4it.co.uk/custom-map/travel/regional-maps.html
  317. Decorative & Reference
    https://dash4it.co.uk/custom-map/decorative.html
  318. Historic Maps
    https://dash4it.co.uk/custom-map/decorative/historic-maps.html
  319. Physical Maps
    https://dash4it.co.uk/custom-map/decorative/physical-maps.html
  320. Political Maps
    https://dash4it.co.uk/custom-map/decorative/political-maps.html
  321. World Maps
    https://dash4it.co.uk/custom-map/decorative/world-maps.html
  322. Wall Maps
    https://dash4it.co.uk/print-on-demand-wall-maps.html
  323. UK Postcode Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/uk-postcode-wall-maps.html
  324. Postcode Area Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/uk-postcode-wall-maps/postcode-area-maps.html
  325. Postcode District Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/uk-postcode-wall-maps/postcode-district-maps.html
  326. Postcode Sector Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/uk-postcode-wall-maps/postcode-sector-maps.html
  327. City Centre Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/uk-postcode-wall-maps/city-centre-maps.html
  328. Custom Postcode Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/uk-postcode-wall-maps/custom-postcode-maps.html
  329. History & Discovery
    https://dash4it.co.uk/print-on-demand-wall-maps/history-discovery.html
  330. Historical Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/history-discovery/historical-maps.html
  331. Maps of Space
    https://dash4it.co.uk/print-on-demand-wall-maps/history-discovery/maps-of-space.html
  332. Oceans
    https://dash4it.co.uk/print-on-demand-wall-maps/history-discovery/oceans.html
  333. War Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/history-discovery/war-maps.html
  334. Discovery
    https://dash4it.co.uk/print-on-demand-wall-maps/history-discovery/discovery.html
  335. Administrative & Boundary
    https://dash4it.co.uk/print-on-demand-wall-maps/administative-boundary-maps.html
  336. Hemisphere Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/administative-boundary-maps/hemisphere-maps.html
  337. Country Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/administative-boundary-maps/country-maps.html
  338. World Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/administative-boundary-maps/world-maps.html
  339. Regional Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/administative-boundary-maps/regional-maps.html
  340. State & Territory Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/administative-boundary-maps/state-territory-maps.html
  341. Town City & Metro Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/administative-boundary-maps/town-city-metro-maps.html
  342. Postcode & Zip Code Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/administative-boundary-maps/postcode-zip-code-maps.html
  343. Leisure & Tourism
    https://dash4it.co.uk/print-on-demand-wall-maps/leisure-tourism.html
  344. Travel Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/leisure-tourism/travel-maps.html
  345. Leisure & Topographic Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/leisure-tourism/leisure-topographic-maps.html
  346. Environment, Resources & Transport
    https://dash4it.co.uk/print-on-demand-wall-maps/environment-resources-and-transport.html
  347. Nature & Wildlife
    https://dash4it.co.uk/print-on-demand-wall-maps/environment-resources-and-transport/nature-wildlife.html
  348. Transport Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/environment-resources-and-transport/transport-maps.html
  349. People & Politics
    https://dash4it.co.uk/print-on-demand-wall-maps/environment-resources-and-transport/people-politics.html
  350. Agriculture & Forestry Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/environment-resources-and-transport/agriculture-forestry-maps.html
  351. Communications
    https://dash4it.co.uk/print-on-demand-wall-maps/environment-resources-and-transport/communications.html
  352. Publisher
    https://dash4it.co.uk/print-on-demand-wall-maps/brand.html
  353. Maps International
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/maps-international.html
  354. A-Z Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/a-z-maps.html
  355. Lucidmap
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/lucidmap.html
  356. XYZ Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/xyz-maps.html
  357. MapSherpa
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/mapsherpa.html
  358. AGT Geocenter
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/agt-geocenter.html
  359. Artokoloro
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/artokoloro.html
  360. Cosmographics
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/cosmographics.html
  361. National Geographic
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/national-geographic.html
  362. Geo4Map
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/geo4map.html
  363. Global Mapping
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/global-mapping.html
  364. Globe Turner
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/globe-turner.html
  365. Groundsure
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/groundsure.html
  366. Hardie Grant
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/hardie-grant.html
  367. Hema Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/hema-maps.html
  368. Inspirit Cartographics
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/inspirit-cartographics.html
  369. Kartographia
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/kartographia.html
  370. Mapping Specialists
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/mapping-specialists.html
  371. Magna Carta Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/magna-carta-maps.html
  372. Meridian Maps
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/meridian-maps.html
  373. Natural Resources Canada
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/natural-resources-canada.html
  374. Oxford Cartographers
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/oxford-cartographers.html
  375. Spatial Vision
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/spatial-vision.html
  376. Twisted Spirit Limited
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/twisted-spirit-limited.html
  377. US Dep. of Agriculture Forest Service
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/united-states-department-of-agriculture-forest-service.html
  378. Westprint
    https://dash4it.co.uk/print-on-demand-wall-maps/brand/westprint.html
  379. Outdoor Kit
    https://dash4it.co.uk/accessories.html
  380. No text
    https://dash4it.co.uk/accessories.html
  381. Accessory Brand
    https://dash4it.co.uk/accessories./brand.html
  382. Silva
    https://dash4it.co.uk/accessories/brand./silva.html
  383. Trekmates
    https://dash4it.co.uk/accessories/brand./trekmates.html
  384. Maglite
    https://dash4it.co.uk/accessories/brand./maglite.html
  385. Leatherman
    https://dash4it.co.uk/accessories/brand./leatherman.html
  386. Victorinox
    https://dash4it.co.uk/accessories/brand./victorinox.html
  387. Bridgedale
    https://dash4it.co.uk/accessories/brand./bridgedale.html
  388. LED Lenser
    https://dash4it.co.uk/accessories/brand./led-lenser.html
  389. LEDLite
    https://dash4it.co.uk/accessories/brand./ledlite.html
  390. Dash4it
    https://dash4it.co.uk/accessories/brand./dash4it.html
  391. Rite in the Rain
    https://dash4it.co.uk/accessories/brand./rite-in-the-rain.html
  392. WigWam
    https://dash4it.co.uk/accessories/brand./wigwam.html
  393. Accessory Type
    https://dash4it.co.uk/accessories./accessory-type.html
  394. Compasses
    https://dash4it.co.uk/accessories/accessory-type./compasses.html
  395. Orienteering Compasses
    https://dash4it.co.uk/accessories/accessory-type./orienteering-compasses.html
  396. Torches
    https://dash4it.co.uk/accessories/accessory-type./torches.html
  397. Multitools
    https://dash4it.co.uk/accessories/accessory-type./multitools.html
  398. Map & Accessory Cases
    https://dash4it.co.uk/accessories/accessory-type./map-cases.html
  399. Gloves & Headwear
    https://dash4it.co.uk/accessories/accessory-type./gloves-headwear.html
  400. Walking Poles
    https://dash4it.co.uk/accessories/accessory-type./walking-poles.html
  401. Dry Bags
    https://dash4it.co.uk/accessories/accessory-type./dry-bags.html
  402. Map Measurers
    https://dash4it.co.uk/accessories/accessory-type./map-measurers.html
  403. Outdoor Essentials
    https://dash4it.co.uk/accessories/accessory-type./outdoor-essential.html
  404. Batteries
    https://dash4it.co.uk/accessories/accessory-type./batteries.html
  405. Chart Plotters
    https://dash4it.co.uk/accessories/accessory-type./chart-plotters.html
  406. Personalised Map Gifts
    https://dash4it.co.uk/accessories/accessory-type./personalised-map-gifts.html
  407. European Travel Essentials
    https://dash4it.co.uk/accessories/accessory-type./european-travel-essentials.html
  408. Jigsaws
    https://dash4it.co.uk/accessories/accessory-type./jigsaws.html
  409. Globes
    https://dash4it.co.uk/accessories./accessory-type/globes.html
  410. Clothing
    https://dash4it.co.uk/accessories./clothing.html
  411. Walking Socks
    https://dash4it.co.uk/accessories/clothing./walking-socks.html
  412. Gaiters
    https://dash4it.co.uk/accessories/clothing./gaiters.html
  413. Gloves
    https://dash4it.co.uk/accessories/clothing./gloves.html
  414. Headwear
    https://dash4it.co.uk/accessories/clothing/headwear-hats-snoods.html
  415. Expedition Kit
    https://dash4it.co.uk/accessories./duke-of-edinburgh-award-kit.html
  416. Expedition Socks
    https://dash4it.co.uk/accessories/duke-of-edinburgh-award-kit./expedition-socks.html
  417. Compasses
    https://dash4it.co.uk/accessories/duke-of-edinburgh-award-kit./compasses.html
  418. Hiking Gaiters
    https://dash4it.co.uk/accessories/duke-of-edinburgh-award-kit./hiking-gaiters.html
  419. Dry Bags
    https://dash4it.co.uk/accessories/duke-of-edinburgh-award-kit/dry-bags.html
  420. Map Cases
    https://dash4it.co.uk/accessories/duke-of-edinburgh-award-kit/map-cases.html
  421. Torches
    https://dash4it.co.uk/accessories/duke-of-edinburgh-award-kit./torches.html
  422. Other Accessories
    https://dash4it.co.uk/accessories/duke-of-edinburgh-award-kit./other-accessories.html
  423. My Basket Items 0 | Total £0.00
    https://dash4it.co.uk/checkout/cart/
  424. Checkout
    https://dash4it.co.uk/checkout/cart/
  425. 30 Percent Off OS Maps
    https://dash4it.co.uk/ordnance-survey-maps.html
  426. Ordnance Survey maps
    http://dash4it.co.uk/ordnance-survey-maps.html
  427. UK Maps
    http://dash4it.co.uk/uk-maps./publisher-brand.html
  428. Guide Books
    http://dash4it.co.uk/guide-books-42.html
  429. European Maps
    http://dash4it.co.uk/european-maps-40.html
  430. International Maps
    http://dash4it.co.uk/world-maps-41.html
  431. Compasses
    http://dash4it.co.uk/accessories/accessory-type./compasses.html
  432. Outdoor Clothing
    http://dash4it.co.uk/accessories./clothing.html
  433. Torches & HeadTorches
    http://dash4it.co.uk/accessories/accessory-type./torches.html
  434. No text
    https://dash4it.co.uk/the-ordnance-survey-puzzle-book.html
  435. The Ordnance Survey Puzzle Tour Of Britain (Blue)
    https://dash4it.co.uk/the-ordnance-survey-puzzle-book.html
  436. No text
    https://dash4it.co.uk/st-g-s-great-british-music-map.html
  437. ST&G's Fastidiously Orchestrated Great British Music Map
    https://dash4it.co.uk/st-g-s-great-british-music-map.html
  438. No text
    https://dash4it.co.uk/the-motor-home-guide-camperstop-europe-2018.html
  439. The Motor Home Guide - Camperstop Europe 2020
    https://dash4it.co.uk/the-motor-home-guide-camperstop-europe-2018.html
  440. No text
    https://dash4it.co.uk/cicerone-walking-the-lake-district-fells-wasdale.html
  441. Cicerone - Walking The Lake District Fells: Wasdale
    https://dash4it.co.uk/cicerone-walking-the-lake-district-fells-wasdale.html
  442. My Account - Log In/Out
    https://dash4it.co.uk/customer/account/
  443. Opening times
    https://dash4it.co.uk/customer-service-opening-times-d4it
  444. Contact us
    https://dash4it.co.uk/contact
  445. Trade enquiries
    https://dash4it.co.uk/trade-enquiries-d4it
  446. Delivery
    https://dash4it.co.uk/delivery
  447. Returns
    https://dash4it.co.uk/returns
  448. Privacy policy
    https://dash4it.co.uk/privacy-policy-d4it
  449. Latest map guarantee
    https://dash4it.co.uk/latest-map-guarantee-d4it
  450. Price match policy
    https://dash4it.co.uk/price-match-policy-page
  451. FAQs
    https://dash4it.co.uk/faqs-d4it
  452. About us
    https://dash4it.co.uk/about-us-d4it
  453. What our customers say
    https://dash4it.co.uk/what-our-customers-say-d4it
  454. Green policy
    https://dash4it.co.uk/green-policy-d4it
  455. Terms & Conditions
    https://dash4it.co.uk/terms-and-conditions-d4it
  456. WEEE disposal
    https://dash4it.co.uk/weee-disposal-d4it
  457. Battery recycling
    https://dash4it.co.uk/battery-recycling-d4it
  458. Free map resources
    https://dash4it.co.uk/free-map-resources-d4it
  459. TIPS & Guides
    https://dash4it.co.uk/how-to-guides-d4it
  460. Mountain Rescue advice
    https://dash4it.co.uk/mountain-rescue-advice-d4it
  461. Blister advice
    https://dash4it.co.uk/blister-advice-d4it
  462. Useful links
    https://dash4it.co.uk/useful-links-d4it
  463. OS rebrand info
    https://dash4it.co.uk/os_rebrand

Links - Internal (nofollow)

19:
  1. national
    https://dash4it.co.uk/catalogsearch/result/?q=national
  2. os 303
    https://dash4it.co.uk/catalogsearch/result/?q=os+303
  3. brecon beacons
    https://dash4it.co.uk/catalogsearch/result/?q=brecon+beacons
  4. park
    https://dash4it.co.uk/catalogsearch/result/?q=park
  5. departmental
    https://dash4it.co.uk/catalogsearch/result/?q=departmental
  6. The
    https://dash4it.co.uk/catalogsearch/result/?q=The
  7. department
    https://dash4it.co.uk/catalogsearch/result/?q=department
  8. europe
    https://dash4it.co.uk/catalogsearch/result/?q=europe
  9. europes
    https://dash4it.co.uk/catalogsearch/result/?q=europes
  10. spey
    https://dash4it.co.uk/catalogsearch/result/?q=spey
  11. Your
    https://dash4it.co.uk/catalogsearch/result/?q=Your
  12. admin
    https://dash4it.co.uk/catalogsearch/result/?q=admin
  13. active
    https://dash4it.co.uk/catalogsearch/result/?q=active
  14. 303
    https://dash4it.co.uk/catalogsearch/result/?q=303
  15. 1
    https://dash4it.co.uk/catalogsearch/result/?q=1
  16. south west coast path
    https://dash4it.co.uk/catalogsearch/result/?q=south+west+coast+path
  17. south west coast
    https://dash4it.co.uk/catalogsearch/result/?q=south+west+coast
  18. south west coa
    https://dash4it.co.uk/catalogsearch/result/?q=south+west+coa
  19. south west
    https://dash4it.co.uk/catalogsearch/result/?q=south+west

Links - Outbound

5:
  1. No text
    https://dash4it-dwnltd.netdna-ssl.com/media/wysiwyg/Price-match-guarantee-strip.png
  2.  
    http://www.facebook.com/Dash4it
  3.  
    https://plus.google.com/u/0/+Dash4itUKMapSuperstore/posts
  4.  
    https://twitter.com/Dash4it
  5. No text
    http://www.caravanclub.co.uk/

Links - Outbound (nofollow)

0:

Keyword Cloud for Dash4it.co.uk

yourwepriceampservicepricesdeliveryukour pricenbsp nbsppolicyourfreenbspallsearchadviceguidesosrrpnoguideordersmapall ordersmapsdwnmagentouijscoreapp

Longtail Keyword Density for Dash4it.co.uk

KeywordsOccurences
our price4
all orders3
nbsp nbsp3
our15
maps8
map8
price6
nbsp6
amp5
all5
we4
prices4
service4
rrp4
free4
uk4
guide3
os3
search3
your3
magentouijscoreapp3
orders3
guides3
delivery3
no3
policy3
dwn3
advice3

Dash4it.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Dash4it.co.uk is a scam?

Websites with Similar Names

Dash44.pl
Moda Italiana | Kraków Dash44
Dash4cash.co.uk
Dash 4 Cash
Dash4it.co.uk
The Specialist Map and Travel Guide Store
Dash4lashes.com
Younique by Rachel Sheaffer

Recently Updated Websites

Holywholesale.com 2 seconds ago.Projectsave.org 3 seconds ago.Hotelvermont.com 3 seconds ago.Droetker.ro 3 seconds ago.Beaverdamlockandsecurity.com 3 seconds ago.Kaukomarkkinat.fi 4 seconds ago.Stanz.org 6 seconds ago.Championsofpurity.com 6 seconds ago.Quine.org 7 seconds ago.Bcnurbanhotelsgranducat.com 8 seconds ago.Cbchealth.info 8 seconds ago.Maisyfun.com 8 seconds ago.Cocktaildeviata.com 9 seconds ago.Oxogoodcookies.com 9 seconds ago.Pojenski.com 10 seconds ago.Inudeteen.net 10 seconds ago.Eqcarpets.com 11 seconds ago.Giovanniroselli.com 11 seconds ago.Umemusic.com 11 seconds ago.Aslibra.com 12 seconds ago.Treeoflifetaichi.com 12 seconds ago.Pagebench.com 13 seconds ago.Highthymecuisine.com 13 seconds ago.Avertas.ch 14 seconds ago.Andys-deli.com 14 seconds ago.Artejuntas.com.br 14 seconds ago.Levenementprecis.com 14 seconds ago.Blasttheshow.com 15 seconds ago.Dowagiacmichiganchiropractor.com 16 seconds ago.Shangrilafarms.org 16 seconds ago.