Главная :: ddgroupclub.win Открытый Торрент-трекер программного обеспечения

Safety: Low trust score
Year Founded: 2013
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-11-05

ДДгрупклуб DDGroupClub.win Открытый торрент трекер, Фильмы, Программы Soft, Мультфильмы, Игры.


Domain summary

Domain label
ddgroupclub
Domain extension
ru
Domain registered:
2013-09-24
Domain updated:
2020-11-05
Domain expires:
2021-09-24
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is ddgroupclub.ru ranked relative to other sites:

Percentage of visits to ddgroupclub.ru from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Ddgroupclub.ru registered?
A: Ddgroupclub.ru was registered 7 years, 5 months, 1 week, 9 hours, 51 minutes, 2 seconds ago on Tuesday, September 24, 2013.
Q: When was the WHOIS for Ddgroupclub.ru last updated?
A: The WHOIS entry was last updated 3 months, 3 weeks, 5 days, 9 hours, 51 minutes, 2 seconds ago on Thursday, November 5, 2020.
Q: What are Ddgroupclub.ru's nameservers?
A: DNS for Ddgroupclub.ru is provided by the following nameservers:
  • bob.ns.cloudflare.com
  • ruth.ns.cloudflare.com
Q: Who is the registrar for the Ddgroupclub.ru domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for Ddgroupclub.ru?
A: Ddgroupclub.ru has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Ddgroupclub.ru each day?
A: Ddgroupclub.ru receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Ddgroupclub.ru resolve to?
A: Ddgroupclub.ru resolves to the IPv4 address 198.100.147.61.
Q: In what country are Ddgroupclub.ru servers located in?
A: Ddgroupclub.ru has servers located in the Canada.
Q: What webserver software does Ddgroupclub.ru use?
A: Ddgroupclub.ru is powered by Nginx/1.10.1 webserver.
Q: Who hosts Ddgroupclub.ru?
A: Ddgroupclub.ru is hosted by OVH SAS in Quebec, Montreal, Canada, H3a.
Q: How much is Ddgroupclub.ru worth?
A: Ddgroupclub.ru has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Ddgroupclub.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Ddgroupclub.ru Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Ddgroupclub.ru

H1 Headings

1 :
  1. Список форумов ddgroupclub.win

H2 Headings

0 :

H3 Headings

24 :
  1. Голосуй за трекер
  2. Поддержать трекер
  3. Telegram
  4. Мы Вконтакте
  5. Друзья проекта
  6. Рекомендуем релиз
  7. Твиты
  8. Новости трекера
  9. Новости в сети
  10. •Новости:
  11. •Правила; FAQ; Обсуждения:
  12. •Операционные системы:
  13. •Авторские раздачи:
  14. •Софт и все вокруг:
  15. •Игры:
  16. •Видео:
  17. •Документалистика, Телепередачи, Спорт, Юмор:
  18. •Музыка:
  19. •Всё для детей и родителей:
  20. •КПК и Мобильные устройства:
  21. •Всё для Apple:
  22. •Книги и Обучающие материалы:
  23. Temp
  24. Кто сейчас на форуме

H4 Headings

96 :
  1. Windows 7 Ultimate SP1 x86x64 By Vladios13 v.09.10 [Ru]
  2. Windows 10 1803 Pro x86x64 By Vladios13 v.09.10
  3. Windows 10 Pro 1709 x86x64 By Vladios13 v.22.10
  4. Windows 8.1 Pro x64 By Vladios13 v.29.04 [Ru]
  5. Windows 7 Ultimate SP1 x86 By Vladios13 v.29.04 [Ru]
  6. Windows 7 Ultimate SP1 x64 By Vladios13 v.29.04 [Ru]
  7. Windows 7 Starter SP1 x86 By Vladios13 v.21.07 [Ru]
  8. Windows 7 Ultimate SP1 x64 By Vladios13 v.28.04 [Ru]
  9. Windows 7 SP1 Home Premium x64 by vladios13 & dragon
  10. Windows 7 SP1 Starter x86 [v16.04] by vladios13
  11. Windows 7 Ultimate SP1 x64 By Vladios13 v.03.03
  12. Microsoft Windows 10 - Оригинальные образы от Microsoft MSDN [Ru]
  13. Windows 10 Enterprise LTSB x64 by vladios13 & liveonloan [13.12] [RU]
  14. Windows 8.1 Enterprise x64 with Update (January) [v.09.01]by DDGroup™[Ru]
  15. •Новости в сети:
  16. Новости трекера
  17. Поздравляем !
  18. •Правила:
  19. •Вопросы и обсуждения:
  20. •Операционные системы от Microsoft:
  21. •Linux, Unix и другие ОС:
  22. •Изменение интерфейса:
  23. •Активация OS Windows и всё, что с ней связано:
  24. •DDGroup™ Edition:
  25. •vladios13:
  26. •Vannza:
  27. • Beslam™ Edition:
  28. •YelloSoft:
  29. • KottoSOFT:
  30. •KSD66:
  31. • IZUAL
  32. • Batman
  33. • m0nkrus
  34. •Утилиты, Офис, Интернет:
  35. •Безопасность:
  36. •Мультимедиа и Графика:
  37. •Софт и оболочки для специалистов, Прочее:
  38. •Материалы для мультимедиа и дизайна
  39. •Форум Игры:
  40. •Windows PC - Игры:
  41. •Windows PC - Старые Игры:
  42. •Nix Игры:
  43. •Консольные Игры:
  44. •Горячие новинки:
  45. •Отечественное кино:
  46. •Зарубежное кино:
  47. •Классика кино и Фильмы до 90-х:
  48. •Артхаус:
  49. •Театр и Музыкальное видео:
  50. •Cериалы:
  51. •Остальное:
  52. •Зарубежные TV-бренды:
  53. •Документалистика и Телепередачи:
  54. •Спорт и активный отдых:
  55. •Юмор:
  56. •Форум Музыка:
  57. •HD Audio и Многоканальная Музыка:
  58. •Классика:
  59. •Jazz, Blues, Soul:
  60. •Шансон, Авторская и Военная песня:
  61. •Rock, Alternative, Punk, Metal:
  62. •Pop:
  63. •Electronic:
  64. •Rap, Hip-hop, RnB, Reggae:
  65. •Музыка восточной Азии:
  66. •Other Styles:
  67. •Неофициальные сборники:
  68. •Форум для родителей:
  69. •Видео:
  70. •Мультфильмы:
  71. •Аудио:
  72. •Литература и прочие Обучающие материалы:
  73. •Детские PC Игры:
  74. •Форум:
  75. •Программы, Игры и прочее:
  76. •Мультимедиа и прочее:
  77. •OS X (Apple/Hackintosh):
  78. •Программы для OS X:
  79. •Игры для OS X:
  80. •Мобильные устройства Apple:
  81. •Аудио и Видео:
  82. Информация о разделе
  83. •О книгах и не только:
  84. •Научная и техническая литература:
  85. •Компьютерная литература:
  86. •Художественная литература:
  87. •Комиксы:
  88. •Обучающие аудиоматериалы:
  89. •Обучающие видеоматериалы:
  90. •Художественные аудиокниги и публицистика:
  91. •Мультимедийные материалы:
  92. •Журналы:
  93. •Автомобили:
  94. •Религии и культы:
  95. •Разное:
  96. Мусорка

H5 Headings

0 :

H6 Headings

78 :
  1. Microsoft выпустит браузер...
  2. Зачисление Upload за голос.
  3. C Днём Рождения, vladios13...
  4. Как сделать скриншоты, если...
  5. СРОЧНО НУЖНА ПОМОЩЬ УВАЙСУ...
  6. Microsoft Windows 10 Enterpr...
  7. antiX Linux 19.2 Hannie...
  8. Новые темы для оформления...
  9. Windows 10 Digital Activatio...
  10. Windows 8.1 Pro vl x64 with...
  11. Windows 7 Ultimate SP1...
  12. Windows 8.1 x86 Enterprise...
  13. Windows 7 Ultimate SP1...
  14. MInstAll v.19.01.2020 By...
  15. Windows 7 sp1 11 in 1...
  16. WPI BY ksd66 V10.6 (x86-X64)...
  17. Windows 10, Version 20H2...
  18. Iso Downloader by batman...
  19. Windows 10 (v20H2) RUS-ENG...
  20. PowerISO 7.8 [Multi/Ru]
  21. Kaspersky Internet Security...
  22. inPixio Photo Cutter 10.4.76...
  23. MInstAll v.05.11.2020 By...
  24. ViSoft.Premium v2007.04...
  25. Grand Theft Auto V обсуждени...
  26. Mortal Kombat 11 Premium...
  27. Factorio (Wube Software...
  28. Sacred: Gold Edition (ASCARO...
  29. Pro Evolution Soccer 2018...
  30. Новые мутанты / The New...
  31. Эдуард Стрельцов. Расплата...
  32. Страшилы / The Frighteners...
  33. Игла (1988) BDRip [H.264/108...
  34. Фауст / Faust (Фридрих Вильг...
  35. VA - Зарубежные клипы...
  36. Банды Лондона / Gangs of...
  37. Watch Dogs (2014) WEBRip...
  38. Пандемия: Коронавирус /...
  39. Танцы / 7 сезон / 1-6 выпуск...
  40. Бокс. Александр Усик - Дерек...
  41. КВН-2020. Премьер лига [1-6...
  42. Rock) The Beatles Discograph...
  43. VA - Шедевры Классики [Part...
  44. VA - Jazz Ballads Vol. 3...
  45. Стас Михайлов - Шестое чувст...
  46. Draconian - Under A Godless...
  47. VA - Bravo The Hits 2020...
  48. DJ Sven & Marc Hartman -...
  49. Groove Da Praia - The...
  50. Madonna - Madame X [2CD...
  51. Sonic Scope - Yoga Chakra...
  52. VA - не Громкие новинки неде...
  53. Домовой (Евгений Бедарев)...
  54. Мир Юрского периода: Лагерь...
  55. VA - Пусть всегда будет солн...
  56. Марина Талер (сост.) | Перел...
  57. Сборник новых игр от Alawar~...
  58. Adguard Premium 4.0.37...
  59. Грейхаунд / Greyhound (Аарон...
  60. macOS Mojave 10.14 (18A391)...
  61. AdGuard 2.5.0.902 (2020)...
  62. The Witcher 2: Assassins of...
  63. Joyoshare HEIC Converter...
  64. Американец / The American...
  65. Правила оформления раздач в...
  66. Скотт Мюллер
  67. Стивен Хокинг - Краткие отве...
  68. Пол Дейтел, Харви Дейтел |...
  69. Библиотека Flibusta на...
  70. Андрей Курпатов | Ком...
  71. Ю.С. Веселова | ЕГЭ 202...
  72. javaops.ru | Junior Java-раз...
  73. Владимир Ленин | Государство...
  74. Форекс для начинающих...
  75. Журнал | Хакер №6 (255) (июн...
  76. Автомобили УАЗ-374195, УАЗ-3...
  77. Чванов Андрей - Аудио БИБЛИЯ...
  78. Казан & Мангал со Сталико...

Total IFRAMEs

1 :

Total Images

166 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-38971936-2

Links - Internal

1392:

Links - Internal (nofollow)

1:

Links - Outbound

8:

Links - Outbound (nofollow)

1:

Keyword Cloud for Ddgroupclub.ru

ultimatev2904 ru windowsvladios13 v2904ultimate sp1x86x64vladios13 v2904 ruru windows 7v2904sp1sp1 x64windows0windows 7 ultimateru windowsx64 by vladios13windows 7x86vladios13windows 107 ultimate sp1pro1x647 ultimateruultimate sp1 x64v2904 rux86x64 by vladios13

Who hosts Ddgroupclub.ru?

Ddgroupclub.ru Hosting Provider Information

Hosted IP Address:198.100.147.61
Hosted Hostname:6.bhs.abcvg.ovh
Service Provider:OVH SAS
Hosted Country:CanadaCA
Location Latitude:45.5063
Location Longitude:-73.5795
Webserver Software:nginx/1.10.1

Is "OVH SAS" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
OVH SAS
1.3540%

HTTP Header Analysis for Ddgroupclub.ru

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.10.1
Date: Thu, 05 Nov 2020 19:53:16 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Frame-Options: SAMEORIGIN
Content-Encoding: gzip

Ddgroupclub.ru Domain Nameserver Information

HostIP AddressCountry
bob.ns.cloudflare.com 173.245.59.104
ruth.ns.cloudflare.com 173.245.58.143


Need to find out who hosts Ddgroupclub.ru?


Domain Registration (WhoIs) information for Ddgroupclub.ru

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: DDGROUPCLUB.RU
nserver: bob.ns.cloudflare.com.
nserver: ruth.ns.cloudflare.com.
state: REGISTERED, DELEGATED, VERIFIED
person: Private Person
registrar: R01-RU
admin-contact: https://partner.r01.ru/contact_admin.khtml
created: 2013-09-24T19:18:45Z
paid-till: 2021-09-24T20:18:45Z
free-date: 2021-10-25
source: TCI

Last updated on 2020-09-08T07:26:30Z

Websites with Similar Names

Ddgroup.hu
DDGroup
Ddgroup.ru
Аренда торговых помещений (площадей) в Калининграде.
Ddgroupclub.ru
Главная :: ddgroupclub.win Открытый Торрент-трекер программного обеспечения
Ddgroupllc.com
D&D Group, LLC - Home
Ddgrowth.com
ddgrowth.com Is for Sale

Recently Updated Websites

Oilchangeco.com (3 seconds ago.)Gkssunnaoup.org (4 seconds ago.)Atouchofitalypizza.com (4 seconds ago.)Brightoncreativestudio.com (4 seconds ago.)Fasystems-uk.com (5 seconds ago.)Bitcoinsilverwallet.com (7 seconds ago.)Teasanjuans.com (10 seconds ago.)Keepitprinting.com (10 seconds ago.)Impact-trailers.info (11 seconds ago.)Talentfromhome.com (12 seconds ago.)Myfhlc.com (13 seconds ago.)2worldtravelers.com (14 seconds ago.)Birbachilegge.com (15 seconds ago.)Greencanalview.com (17 seconds ago.)Remixgodsuede.com (17 seconds ago.)Caimcomfort.com (18 seconds ago.)Verdemagico.com (18 seconds ago.)Advantagebase.com (19 seconds ago.)Rlabs.site (23 seconds ago.)Riverbendgolfwv.com (25 seconds ago.)Forcevalue.com (27 seconds ago.)Mgn365.com (29 seconds ago.)Milanoprecutwigs.com (30 seconds ago.)Pickjanet.com (31 seconds ago.)Tx443.com (33 seconds ago.)Antaios.online (33 seconds ago.)Sherpastravel.com (34 seconds ago.)Lanmao66.com (34 seconds ago.)Hairtransplantinistanbul.org (35 seconds ago.)Processserving.solutions (37 seconds ago.)

Recently Searched Keywords

nomad street kid corpo (1 second ago.)carousel-75 rpc-content (8 seconds ago.)active 4 lessons (10 seconds ago.)ahover (11 seconds ago.)cmds to see (11 seconds ago.)st dunstans (11 seconds ago.)preferences backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11promotitle (15 seconds ago.)vu cua (15 seconds ago.)vng cc n (18 seconds ago.)hitogel 45 (19 seconds ago.)colorantes para jabones (19 seconds ago.)b7 oil gmbh (19 seconds ago.)1 if (20 seconds ago.)vng cc (20 seconds ago.)vng c nhiu (22 seconds ago.)vng c (24 seconds ago.)vn n (26 seconds ago.)vn chuyn nhanh (28 seconds ago.)vn chuyn hng (31 seconds ago.)con motore (32 seconds ago.)vn chuyn d (33 seconds ago.)preferences backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11promotitle (33 seconds ago.)motoriduttori epicicloidali con motore dc a spazzole vedi i prodottivedi i prodotti (33 seconds ago.)micromotorssrl (34 seconds ago.)vn chuyn (35 seconds ago.)28 october 2020 (36 seconds ago.)motoriduttori a cascata con motore dc a spazzole vedi i prodottivedi i prodotti (37 seconds ago.)il nostro nuovo sito è online! (41 seconds ago.)motore dc (42 seconds ago.)powered by promo.it (43 seconds ago.)