12140 gebrauchte Fahrräder in Deutschland: Fahrrad gebraucht kaufen & verkaufen

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-24
Category: Shopping > Coupons

Kaufe oder verkaufe gebrauchte Fahrräder deutschlandweit in unserer Online-Fahrradbörse und informiere dich über verschiedene Fahrradtypen und Fahrradhersteller.


Domain summary

Domain label
dealmywheel
Domain extension
de
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is dealmywheel.de ranked relative to other sites:

Percentage of visits to dealmywheel.de from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Dealmywheel.de registered?
A: Dealmywheel.de was registered 4 months, 4 days, 13 hours, 31 minutes, 21 seconds ago on Saturday, October 24, 2020.
Q: When was the WHOIS for Dealmywheel.de last updated?
A: The WHOIS entry was last updated 9 years, 6 months, 3 weeks, 6 days, 13 hours, 31 minutes, 21 seconds ago on Monday, August 1, 2011.
Q: What are Dealmywheel.de's nameservers?
A: DNS for Dealmywheel.de is provided by the following nameservers:
  • ns1.kcs-netz.de
  • ns2.kcs-netz.de
Q: Who is the registrar for the Dealmywheel.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Dealmywheel.de?
A: Dealmywheel.de has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Dealmywheel.de each day?
A: Dealmywheel.de receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Dealmywheel.de resolve to?
A: Dealmywheel.de resolves to the IPv4 address 94.130.181.162.
Q: In what country are Dealmywheel.de servers located in?
A: Dealmywheel.de has servers located in the Germany.
Q: What webserver software does Dealmywheel.de use?
A: Dealmywheel.de is powered by Apache/2.4.25 (Debian) webserver.
Q: Who hosts Dealmywheel.de?
A: Dealmywheel.de is hosted by D2 International Investment Ukraine LLC in Germany.
Q: How much is Dealmywheel.de worth?
A: Dealmywheel.de has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Dealmywheel.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Dealmywheel.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Dealmywheel.de

H1 Headings

1 :
  1. DealMyWheel.de – Die Fahrradbörse für neue und gebrauchte Fahrräder

H2 Headings

12 :
  1. Wo suchst Du Dein Fahrrad ...? 
  2. 12140 Fahrräder gebraucht und neu online!
  3. Neue & gebrauchte Fahrräder kaufen oder verkaufen - du hast die Wahl!
  4. Elektrofahrräder: Der Trend greift um sich
  5. Die Fahrradsuche - so findest du dein Fahrrad auf der Fahrradbörse DealMyWheel.de
  6. Finde neue & gebrauchte Fahrräder in deinem Umfeld!
  7. Die Fahrradhersteller, von BULLS bis Specialized und noch mehr!
  8. Zeige deinen Freunden auf Facebook was dir gefällt!
  9. Neue oder gebrauchte Fahrräder in der Fahrradbörse richtig verkaufen
  10. Verkaufe dein Fahrradzubehör ganz einfach in der Fahrradbörse
  11. Neues oder gebrauchtes Fahrradzubehör in der Online Fahrradbörse suchen
  12. Fahrradbörse DealMyWheel.de - für Fahrradhändler

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

26 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-34397005-1

Links - Internal

44:

Links - Internal (nofollow)

0:

Keyword Cloud for Dealmywheel.de

neue oder gebrauchtenichtrennraddie mglichkeitfahrradbrse dealmywheeldeonline fahrradbrseelektromotorallesuchstdie sucheder online fahrradbrseberauf derdannmchtest duneuen oderkmhunterfahrradbrse istmachengebrauchtenistneues oderwerdenhastverschiedenendeinbei unsdateneinfachkaufen oderpedelecneueinserierennurunseseinesfahrradbrseverkaufenunsererdasknneneinenwebsitecitybikeneuen oder gebrauchtenfrumneuenschrittenoder gebrauchtes fahrradoder gebrauchtenstadtbeibietendukostenlosmitoder gebrauchteskannzupassendesder onlinebisauffahrrder in derauchneues oder gebrauchtesdeinesichneue gebrauchtedencookieseinkannstder fahrradbrsewiegebrauchte fahrradkaufenodermalauf unsereripadresseder websitegoogledichneue gebrauchte fahrrdersindoder gebrauchte fahrradneuderausganzdemmchtestvon googleinseratfindest dudeskann manfahrradbrse frfahrradzubehrdiedu dichnachdirauf demdurchgebrauchte fahrrderfindestoder einmanfacebookgebrauchtesneue und gebrauchtedu einvonebikesfahrrad verkaufenzumimdieserneue oderunserer fahrradbrseneuessodu deinelektrofahrrderanderenwirperdealmywheeldeeinezum beispielangezeigtdu dirdenninformationenkannst duelektrofahrradfindenebikefahrraddeinemfahrrderganz einfachoder gebrauchtebeispielfahrrad kaufenfahrradhndlerwirdeinemdirektmglichkeitonlinedeinengebrauchtes fahrradgebrauchteortobsucheanzeige

Longtail Keyword Density for Dealmywheel.de

KeywordsOccurences
neue oder gebrauchte5
neues oder gebrauchtes4
der online fahrradbrse4
neue und gebrauchte3
neue gebrauchte fahrrder3
oder gebrauchtes fahrrad3
oder gebrauchte fahrrad3
neuen oder gebrauchten3
fahrrder in der3
kannst du13
gebrauchte fahrrder9
ganz einfach8
online fahrradbrse7
der fahrradbrse6
du dein5
von google5
gebrauchte fahrrad5
oder gebrauchte5
neue oder5
der website5
du ein5
fahrrad kaufen5
kann man4
oder gebrauchten4
zum beispiel4
kaufen oder4
der online4
mchtest du4
neues oder4
oder gebrauchtes4
gebrauchtes fahrrad4
fahrradbrse dealmywheelde4
die suche3
du dich3
fahrradbrse ist3
unserer fahrradbrse3
neue gebrauchte3
neuen oder3
fahrrad verkaufen3
die mglichkeit3
auf der3
findest du3
bei uns3
du dir3
auf dem3
fahrradbrse fr3
oder ein3
auf unserer3
du38
oder37
die36
der34
fahrrad22
auf20
ein19
fahrradbrse19
einfach16
ist16
das15
kannst15
zu14
gebrauchte14
von14
fahrrder13
fr13
dir12
verkaufen12
bei12
ganz12
neue12
google12
dein11
den11
kaufen10
mit9
auch9
online9
gebrauchten8
es8
nicht8
mchtest7
werden7
kann7
website7
dealmywheelde7
dann7
dich6
zum6
aus6
deine6
wird6
sind6
dem6
einem6
man6
neues6
eine6
fahrradzubehr6
neuen6
unserer6
ort5
unter5
wie5
wir5
ber5
gebrauchtes5
beispiel4
knnen4
elektrofahrrad4
einen4
hast4
suche4
so4
nach4
finden4
deinen4
cookies4
elektrofahrrder4
facebook4
elektromotor4
ob4
inserat4
deinem3
ip-adresse3
mal3
anzeige3
mglichkeit3
informationen3
per3
passendes3
inserieren3
anderen3
fahrradhndler3
stadt3
daten3
direkt3
kostenlos3
angezeigt3
sich3
suchst3
neu3
citybike3
rennrad3
bieten3
verschiedenen3
e-bike3
machen3
schritten3
um3
denn3
alle3
im3
e-bikes3
kmh3
eines3
nur3
uns3
pedelec3
dieser3
des3
bis3
findest3
durch3

Who hosts Dealmywheel.de?

Dealmywheel.de Hosting Provider Information

Hosted IP Address:94.130.181.162
Hosted Hostname:static.162.181.130.94.clients.your-server.de
Service Provider:D2 International Investment Ukraine LLC
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Apache/2.4.25 (Debian)

Is "D2 International Investment Ukraine LLC" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
D2 International Investment Ukraine LLC
0.1030%

HTTP Header Analysis for Dealmywheel.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 24 Oct 2020 20:18:33 GMT
Server: Apache/2.4.25 (Debian)
X-Powered-By: PHP/7.2.13
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 7778
Content-Type: text/html; charset=utf-8

Dealmywheel.de Domain Nameserver Information

HostIP AddressCountry
ns1.kcs-netz.de 212.162.56.27
ns2.kcs-netz.de 213.203.243.202


Need to find out who hosts Dealmywheel.de?


Domain Registration (WhoIs) information for Dealmywheel.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: dealmywheel.de
Nserver: ns1.kcs-netz.de
Nserver: ns2.kcs-netz.de
Status: connect
Changed: 2011-08-01T18:40:04+02:00

Websites with Similar Names

Dealm.nl
dealm.nl -&nbspdealm Resources and Information.
Dealma.cafe
dealma.cafe - Registered at Namecheap.com
Dealmaal.com
HugeDomains.com - Shop for over 300,000 Premium Domains
Dealmaar.com
Online Shopping Store | Buy Online: Computer Appliances, Mobile Phones, Fashionwear, Office Supplies, Electronics & Appliances, Hardware & Accesories | Best Price shop in India @ DealmAAr
Dealmaar.net
Welcome to DEALMAAR.NET

Recently Updated Websites

Lai67.com (4 seconds ago.)Goodcreditgoals.com (5 seconds ago.)Paragonfortune.com (5 seconds ago.)Floorfabrik.com (6 seconds ago.)Accubase.net (6 seconds ago.)Ekwacha.org (7 seconds ago.)Gretagrigas.com (7 seconds ago.)Hstation.us (9 seconds ago.)Bandhavam.com (9 seconds ago.)Itracktennis.com (11 seconds ago.)Placitaparkapts.com (11 seconds ago.)Employerscompliance.com (11 seconds ago.)200387762.xyz (13 seconds ago.)Leyu3864.vip (13 seconds ago.)Seanchristophertsen.com (14 seconds ago.)Esdelbueno.com (15 seconds ago.)Siouxpercon.org (16 seconds ago.)Creativecowstockyard.com (16 seconds ago.)Palmocapital.com (17 seconds ago.)Wedgletreeinjector.com (18 seconds ago.)Coopernike.com (19 seconds ago.)Ambicagro.com (20 seconds ago.)Learningtablehomeschool.com (20 seconds ago.)Anglaismaison.com (21 seconds ago.)Mekten.com (23 seconds ago.)Rootedtouch.com (24 seconds ago.)12monthholidays.com (24 seconds ago.)Luxuryhomesincharlotte.com (25 seconds ago.)Chateauforum.net (26 seconds ago.)Bydianaherrera.com (26 seconds ago.)

Recently Searched Keywords

houden (2 seconds ago.)iva incluido (7 seconds ago.)upon (10 seconds ago.)process your request (12 seconds ago.)meets bagel dating (15 seconds ago.)ryuudou temple real life (17 seconds ago.)assembly 260 easing (22 seconds ago.)women watches (25 seconds ago.)0 48 075 (26 seconds ago.)pull (30 seconds ago.)sign in  (31 seconds ago.)ljude (32 seconds ago.)gratis ongkir cashback (34 seconds ago.)2px 4px 0 (34 seconds ago.)chả mực hạ long – đặc sản vịnh hạ long – say đắm mọi thực khách (38 seconds ago.)tai wah segamat (38 seconds ago.)серьги листики из бисера (41 seconds ago.)8112013 since (42 seconds ago.)vcr must (43 seconds ago.)storm playa del carmen (44 seconds ago.)075 -moz-box-shadow 1px (46 seconds ago.)uçangargi (48 seconds ago.)smk telekomedika (49 seconds ago.)selectdata-previewerror style-kf5hbs8lnavcontainerarrow (50 seconds ago.)выездная церемония (51 seconds ago.)n paragraph-qtjfup6rltext-output paragraph-qtjfup6rl (52 seconds ago.)left color var--colortext (52 seconds ago.)inteligentny dom fibaro (55 seconds ago.)vic th (57 seconds ago.)effetto (1 minute 2 seconds ago.)