|  DPIC | Death Penalty Information Center
Low trust score  | Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:D
Alexa Rank Alexa Rank:73,596
Majestic Rank Majestic Rank:11,821
Domain Authority Domain Authority:72%
DMOZ DMOZ Listing:No

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Registry Domain ID: D31492255-LROR
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2017-07-11T16:40:33Z
Creation Date: 2000-07-17T19:53:40Z
Registry Expiry Date: 2018-07-17T19:53:40Z
Registrar Registration Expiration Date:
Registrar: Tucows Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Registry Registrant ID: C191639998-LROR
Registrant Name: Contact Privacy Inc. Customer 0147964912
Registrant Organization: Contact Privacy Inc. Customer 0147964912
Registrant Street: 96 Mowat Ave
Registrant City: Toronto
Registrant State/Province: ON
Registrant Postal Code: M6K 3M1
Registrant Country: CA
Registrant Phone: +1.4165385457
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C191639998-LROR
Admin Name: Contact Privacy Inc. Customer 0147964912
Admin Organization: Contact Privacy Inc. Customer 0147964912
Admin Street: 96 Mowat Ave
Admin City: Toronto
Admin State/Province: ON
Admin Postal Code: M6K 3M1
Admin Country: CA
Admin Phone: +1.4165385457
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C191639998-LROR
Tech Name: Contact Privacy Inc. Customer 0147964912
Tech Organization: Contact Privacy Inc. Customer 0147964912
Tech Street: 96 Mowat Ave
Tech City: Toronto
Tech State/Province: ON
Tech Postal Code: M6K 3M1
Tech Country: CA
Tech Phone: +1.4165385457
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
DNSSEC: signedDelegation
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of WHOIS database: 2017-08-26T20:11:30Z

Who hosts is hosted by pair Networks in Pennsylvania, Pittsburgh, United States, 15203. has an IP Address of and a hostname of and runs Apache/2.2.31 web server. Web Server Information

Hosted IP Address:
Service Provider:pair Networks
Hosted Country:United StatesUS
Location Latitude:40.4249
Location Longitude:-79.981
Webserver Software:Apache/2.2.31

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 02 Jul 2015 11:53:25 GMT
Server: Apache/2.2.29
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Cache-Control: no-cache, must-revalidate, post-check=0, pre-check=0
Content-Language: en
Link:; rel="shortlink",; rel="canonical"
X-Generator: Drupal 7 (
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

convictedconvictionpersonhis deathannouncedwroteoutwehimjurysayorange countysupportaugust 212withoutshoulddnacircumstancewe do not9court ruledcorpusresultscould notpracticesomeinjectionunconstitutionallynbsp in arbitrarinessbecausecallingaggravating circumstancegoingfloridasoverturnedmore thanboard3scheduledstfiveusewilliamss lawyerssentencesparticipatedattorneyspresentremovedcourts decisionhomegivendoziernoamericansnew voicesdistrict attorneys officeyetcapital punishmentrowprosecutorarbitrariness what039s newdeathendamericanrabbispeoplenevergoethalsdeathrow prisonerarizonawhichsarminahoweverjustice systemdecadessystemeighthpresentedfactrepresentationringlimitspennsylvania supreme courtconvictionsdistrictmentallyfollowingnewscarry outcalledpodcastsdeath sentenceorderhistorystay his executionspeedeligiblephiladelphia districtunconstitutionalwhilearizonasdefendantsalsopostedissuesthey wroteresentencingthemlawyerexecutivevoicesuponjewishpolicepennsylvania supremestate courtsusexecutionspursuingwrongful convictionsjohnsonlargestscottproceedingsvotehis executioninitiativeoftenreadssexuallyall butkniferesourcesyearsotherjanssenexecutedwhitepursuing the deathmostgovernorswithinsheriffscausesdistrict attorneysmarcellusaggravating circumstancesonlyrolemurderhave beenamp johnsonafterdateadministeredsupreme courtscriminalvictimfirstappealpenalty againstcasesusingmarcellus williamsampcapitaltimepetitionstatementus supremedefendantmakedecidednbsp in what039swebsayingblackcourt hadcounty district attorneyshad beendruglikelywhat039sactionupheldaccusedmedicalamendmentwhosementalasays executionteamdpicfraziertheresetfacingspeed upraciallyissuedreadclaim8prosecutionlawyersdeath sentencesprioraccused of killingtrialstay of executiondecisionappealsnot4picturedjudgepartlegislativestateshavejamesrecommendations0supreme court hasbeforecriminal justiceracecreatedexecutionchallengeclaimssupremecourt of appealssaysobtainedaugust 24allnonunanimoussupreme courtcompany10county prosecutorsherclemencypagebutjusticesconstitutionvictimscounty districtlethalrulingupcoming executionsnevadapennsylvaniaconstitutionalityanypunishmenteverlawagainstjurorsprosecutorsworst5stay hisundercasedistrict attorneymisconductjohnson amp johnsonarbitrariness what039saggravatingstate hashad participatedst louispenaltysentenced to deathcriminal justice systemhaddo notyearattorneys officemarkdeath penalty againstboard of inquirydecidingnorwoodinnocenceleastfairadmittedmark asaybeingflorida supreme courtseebased7humanitseachlighttheirfiledjudicial biasfailedwhetherwerecarryarkansasmissouriwrongfuldeath rowgeneralreviewnew californiasentence imposedwouldthreehisdespitedrugs1mwilliamsshuman rightswe doourformercalifornia supremedeniedreprievedidthancourt hasmassdividedexecution dateoverdeath penaltyhe saidasaycanprisonersgreenenbspraisetwosceneproposition 66habeas corpusphiladelphiapharmaceuticaldefensetimescondemnedbothcouldfloridadna evidencedatabasetakeus supreme courtmanrightsevidencestatehas beenceoruledtrial courtupcomingaugust 22thirdaugustapplicationhis death sentenceorange county districtdeath penalty casesofficeseverelysentencedattorneyonejusticematchvtheywilliamsjury recommendationsearlieruseddeathpenaltychildsentencingstatement postedcircumstancesyoudirectorcircuitreversedgovernmentrace readprosecutorialstayprisonerprosecutors hadcourtsjudicialjohnson ampmissouri governorstatutepenalty casesgreitenscapital habeasopportunitymusttestimonystate attorneyhabeasposted augustdeathrowmoredivided pennsylvaniafederallouiskillingflorida supremelesspressdeathpenalty appealsdid notcalifornia supreme courtmurder casesinnocentsentencenowsexualsaidhelimitationsintolifeexecutelethal injectiondeath sentence imposedasayscourtarbitrarinessbiasnew executioncauses of wrongfulevenhasinformationupmerck6court has upheldauthorizednonunanimous juryeightdolegalgovernorpropositionwhat039s new californiacountyprocessorangehas upheldbeenreportjohnseekingimposedhearamnestycaliforniainquiryleast onehearingnewwhat039s newnot matchshowedus court

Longtail Keyword Density for

us supreme court11
sentenced to death7
supreme court has5
death penalty against5
district attorneys office5
arbitrariness what039s new4
accused of killing4
nbsp in arbitrariness4
court has upheld4
death sentence imposed3
causes of wrongful3
nbsp in what039s3
orange county district3
court of appeals3
criminal justice system3
county district attorneys3
pennsylvania supreme court3
death penalty cases3
we do not3
california supreme court3
what039s new california3
johnson amp johnson3
his death sentence3
stay his execution3
pursuing the death3
stay of execution3
florida supreme court3
board of inquiry3
death penalty51
supreme court23
death sentence14
us supreme12
capital punishment12
had been11
what039s new11
orange county10
posted august10
more than9
proposition 667
death sentences7
criminal justice7
court has7
trial court6
death row6
district attorneys6
florida supreme5
august 245
has upheld5
penalty against5
attorneys office5
williamss lawyers5
his execution4
court ruled4
has been4
dna evidence4
death-row prisoner4
district attorney4
county prosecutors4
august 224
st louis4
stay his4
mark asay4
he said4
arbitrariness what039s4
new voices4
lethal injection4
his death4
court had3
murder cases3
california supreme3
county district3
speed up3
statement posted3
capital habeas3
all but3
death-penalty appeals3
carry out3
not match3
aggravating circumstance3
aggravating circumstances3
wrongful convictions3
sentence imposed3
non-unanimous jury3
state courts3
they wrote3
we do3
new california3
could not3
us court3
habeas corpus3
justice system3
do not3
state has3
jury recommendations3
upcoming executions3
race read3
divided pennsylvania3
johnson amp3
state attorney3
supreme courts3
have been3
least one3
amp johnson3
august 213
judicial bias3
pennsylvania supreme3
execution date3
new execution3
courts decision3
asays execution3
missouri governor3
prosecutors had3
did not3
human rights3
philadelphia district3
penalty cases3
had participated3
marcellus williams3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?