Deathpenaltyinfo.org Website Information
Website Ranks & Scores for Deathpenaltyinfo.org
 Statvoo Rank: | D |
 Alexa Rank: | 73,596 |
 Majestic Rank: | 11,821 |
 Domain Authority: | 72% |
 DMOZ Listing: | No |
Whois information for deathpenaltyinfo.org
Full Whois Lookup for Deathpenaltyinfo.org Whois Lookup
WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Deathpenaltyinfo.org. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.
Domain Name: DEATHPENALTYINFO.ORG
Registry Domain ID: D31492255-LROR
Registrar WHOIS Server:
Registrar URL: http://www.tucows.com
Updated Date: 2017-07-11T16:40:33Z
Creation Date: 2000-07-17T19:53:40Z
Registry Expiry Date: 2018-07-17T19:53:40Z
Registrar Registration Expiration Date:
Registrar: Tucows Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: C191639998-LROR
Registrant Name: Contact Privacy Inc. Customer 0147964912
Registrant Organization: Contact Privacy Inc. Customer 0147964912
Registrant Street: 96 Mowat Ave
Registrant City: Toronto
Registrant State/Province: ON
Registrant Postal Code: M6K 3M1
Registrant Country: CA
Registrant Phone: +1.4165385457
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C191639998-LROR
Admin Name: Contact Privacy Inc. Customer 0147964912
Admin Organization: Contact Privacy Inc. Customer 0147964912
Admin Street: 96 Mowat Ave
Admin City: Toronto
Admin State/Province: ON
Admin Postal Code: M6K 3M1
Admin Country: CA
Admin Phone: +1.4165385457
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C191639998-LROR
Tech Name: Contact Privacy Inc. Customer 0147964912
Tech Organization: Contact Privacy Inc. Customer 0147964912
Tech Street: 96 Mowat Ave
Tech City: Toronto
Tech State/Province: ON
Tech Postal Code: M6K 3M1
Tech Country: CA
Tech Phone: +1.4165385457
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: CODY.NS.CLOUDFLARE.COM
Name Server: ADA.NS.CLOUDFLARE.COM
DNSSEC: signedDelegation
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-26T20:11:30Z
Who hosts Deathpenaltyinfo.org?
Deathpenaltyinfo.org Web Server Information
| Http-Version: | 1.1 |
| Status-Code: | 200 |
| Status: | 200 OK |
| Date: | Thu, 02 Jul 2015 11:53:25 GMT |
| Server: | Apache/2.2.29 |
| Expires: | Sun, 19 Nov 1978 05:00:00 GMT |
| Cache-Control: | no-cache, must-revalidate, post-check=0, pre-check=0 |
| Content-Language: | en |
| Link: | ; rel="shortlink",; rel="canonical" |
| X-Generator: | Drupal 7 (http://drupal.org) |
| Transfer-Encoding: | chunked |
| Content-Type: | text/html; charset=utf-8 |
Need to find out who hosts Deathpenaltyinfo.org?
Deathpenaltyinfo.org Free SEO Report
Website Inpage Analysis for Deathpenaltyinfo.org
| H1 Headings: | 0 | |
| H2 Headings: | 0 | |
| H3 Headings: | 0 | |
| H4 Headings: | 0 | |
| H5 Headings: | 0 | |
| H6 Headings: | 0 | | |
| Total IFRAMEs: | 0 | |
| Total Images: | 0 | |
| Google Adsense: | Not Applicable | |
| Google Analytics: | Not Applicable | |
Keyword Cloud for Deathpenaltyinfo.org
convictedconvictionpersonhis deathannouncedwroteoutwehimjurysayorange countysupportaugust 212withoutshoulddnacircumstancewe do not9court ruledcorpusresultscould notpracticesomeinjectionunconstitutionallynbsp in arbitrarinessbecausecallingaggravating circumstancegoingfloridasoverturnedmore thanboard3scheduledstfiveusewilliamss lawyerssentencesparticipatedattorneyspresentremovedcourts decisionhomegivendoziernoamericansnew voicesdistrict attorneys officeyetcapital punishmentrowprosecutorarbitrariness what039s newdeathendamericanrabbispeoplenevergoethalsdeathrow prisonerarizonawhichsarminahoweverjustice systemdecadessystemeighthpresentedfactrepresentationringlimitspennsylvania supreme courtconvictionsdistrictmentallyfollowingnewscarry outcalledpodcastsdeath sentenceorderhistorystay his executionspeedeligiblephiladelphia districtunconstitutionalwhilearizonasdefendantsalsopostedissuesthey wroteresentencingthemlawyerexecutivevoicesuponjewishpolicepennsylvania supremestate courtsusexecutionspursuingwrongful convictionsjohnsonlargestscottproceedingsvotehis executioninitiativeoftenreadssexuallyall butkniferesourcesyearsotherjanssenexecutedwhitepursuing the deathmostgovernorswithinsheriffscausesdistrict attorneysmarcellusaggravating circumstancesonlyrolemurderhave beenamp johnsonafterdateadministeredsupreme courtscriminalvictimfirstappealpenalty againstcasesusingmarcellus williamsampcapitaltimepetitionstatementus supremedefendantmakedecidednbsp in what039swebsayingblackcourt hadcounty district attorneyshad beendruglikelywhat039sactionupheldaccusedmedicalamendmentwhosementalasays executionteamdpicfraziertheresetfacingspeed upraciallyissuedreadclaim8prosecutionlawyersdeath sentencesprioraccused of killingtrialstay of executiondecisionappealsnot4picturedjudgepartlegislativestateshavejamesrecommendations0supreme court hasbeforecriminal justiceracecreatedexecutionchallengeclaimssupremecourt of appealssaysobtainedaugust 24allnonunanimoussupreme courtcompany10county prosecutorsherclemencypagebutjusticesconstitutionvictimscounty districtlethalrulingupcoming executionsnevadapennsylvaniaconstitutionalityanypunishmenteverlawagainstjurorsprosecutorsworst5stay hisundercasedistrict attorneymisconductjohnson amp johnsonarbitrariness what039saggravatingstate hashad participatedst louispenaltysentenced to deathcriminal justice systemhaddo notyearattorneys officemarkdeath penalty againstboard of inquirydecidingnorwoodinnocenceleastfairadmittedmark asaybeingflorida supreme courtseebased7humanitseachlighttheirfiledjudicial biasfailedwhetherwerecarryarkansasmissouriwrongfuldeath rowgeneralreviewnew californiasentence imposedwouldthreehisdespitedrugs1mwilliamsshuman rightswe doourformercalifornia supremedeniedreprievedidthancourt hasmassdividedexecution dateoverdeath penaltyhe saidasaycanprisonersgreenenbspraisetwosceneproposition 66habeas corpusphiladelphiapharmaceuticaldefensetimescondemnedbothcouldfloridadna evidencedatabasetakeus supreme courtmanrightsevidencestatehas beenceoruledtrial courtupcomingaugust 22thirdaugustapplicationhis death sentenceorange county districtdeath penalty casesofficeseverelysentencedattorneyonejusticematchvtheywilliamsjury recommendationsearlieruseddeathpenaltychildsentencingstatement postedcircumstancesyoudirectorcircuitreversedgovernmentrace readprosecutorialstayprisonerprosecutors hadcourtsjudicialjohnson ampmissouri governorstatutepenalty casesgreitenscapital habeasopportunitymusttestimonystate attorneyhabeasposted augustdeathrowmoredivided pennsylvaniafederallouiskillingflorida supremelesspressdeathpenalty appealsdid notcalifornia supreme courtmurder casesinnocentsentencenowsexualsaidhelimitationsintolifeexecutelethal injectiondeath sentence imposedasayscourtarbitrarinessbiasnew executioncauses of wrongfulevenhasinformationupmerck6court has upheldauthorizednonunanimous juryeightdolegalgovernorpropositionwhat039s new californiacountyprocessorangehas upheldbeenreportjohnseekingimposedhearamnestycaliforniainquiryleast onehearingnewwhat039s newnot matchshowedus court
What are the nameservers for deathpenaltyinfo.org?
Deathpenaltyinfo.org Domain Nameserver Information
| Host | IP Address | Country |
|---|
| ns000.ns0.com |  | 216.92.61.61 |  United States |
| ns251.pair.com | | 209.68.2.96 | United States |
Why not add a Review?
Have you used deathpenaltyinfo.org before?
Please write a short review to share your views and opinions about deathpenaltyinfo.org.
It's quick and easy to contribute and your view can be completely anonymous if you want!
