Litchfield Park and Goodyear Specialist

Safety: Low trust score
Year Founded: 2000
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Realty One Group



Domain summary

Last updated
2021-05-04
Domain label
debcharlesworthrealtor
Domain extension
us
Domain registered:
2000-09-05
Domain updated:
2021-05-04
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is debcharlesworthrealtor.us ranked relative to other sites:

Percentage of visits to debcharlesworthrealtor.us from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Debcharlesworthrealtor.us registered?
A: Debcharlesworthrealtor.us was registered 20 years, 8 months, 1 week, 2 days, 9 hours, 35 minutes, 22 seconds ago on Tuesday, September 5, 2000.
Q: When was the WHOIS for Debcharlesworthrealtor.us last updated?
A: The WHOIS entry was last updated 1 week, 3 days, 9 hours, 35 minutes, 22 seconds ago on Tuesday, May 4, 2021.
Q: What are Debcharlesworthrealtor.us's nameservers?
A: DNS for Debcharlesworthrealtor.us is provided by the following nameservers:
  • ns64.domaincontrol.com
  • ns63.domaincontrol.com
Q: Who is the registrar for the Debcharlesworthrealtor.us domain?
A: The domain has been registered at NEUSTAR INC..
Q: What is the traffic rank for Debcharlesworthrealtor.us?
A: Debcharlesworthrealtor.us has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Debcharlesworthrealtor.us each day?
A: Debcharlesworthrealtor.us receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Debcharlesworthrealtor.us resolve to?
A: Debcharlesworthrealtor.us resolves to the IPv4 address 184.168.131.241.
Q: In what country are Debcharlesworthrealtor.us servers located in?
A: Debcharlesworthrealtor.us has servers located in the United States.
Q: What webserver software does Debcharlesworthrealtor.us use?
A: Debcharlesworthrealtor.us is powered by Sitedistrict-nginx webserver.
Q: Who hosts Debcharlesworthrealtor.us?
A: Debcharlesworthrealtor.us is hosted by AS-26496-GO-DADDY-COM-LLC in United States.
Q: How much is Debcharlesworthrealtor.us worth?
A: Debcharlesworthrealtor.us has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Debcharlesworthrealtor.us Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Debcharlesworthrealtor.us Free SEO Report

Website Inpage Analysis for Debcharlesworthrealtor.us

H1 Headings

2 :
  1. Litchfield Park and Goodyear Specialist
  2. Do you know what your home is worth?Find Out

H2 Headings

34 :
  1. Litchfield Park Homes for Sale
  2. Old Litchfield Homes for Sale
  3. Palm Valley Homes for Sale
  4. Portales Homes for Sale
  5. Estrella Mountain Ranch Homes for Sale
  6. Verrado Homes for Sale
  7. 12563 W Desert Rose Road Avondale 85392
  8. 12505 W Willow Avenue El Mirage 85335
  9. 13621 N 151st Drive Surprise 85379
  10. 12209 N 65th Place Scottsdale 85254
  11. 843 W Ocotillo Street Casa Grande 85122
  12. 3810 E Esplanade Avenue Gilbert 85297
  13. 1048 W Heather Drive Mesa 85201
  14. 20680 W Hamilton Street Buckeye 85396
  15. 14513 N 99th Street Scottsdale 85260
  16. 6265 W Wolf Street Phoenix 85033
  17. 4645 E Daley Lane Phoenix 85050
  18. 1820 E Dunbar Drive Phoenix 85042
  19. 1717 N 1st Avenue 222 Phoenix 85003
  20. 7232 E Knoll Street Mesa 85207
  21. 3343 W Roanoke Avenue Phoenix 85009
  22. 13441 W Keim Drive Litchfield Park 85340
  23. 2831 E Bart Street Gilbert 85295
  24. 3233 W Abraham Lane Phoenix 85027
  25. 9039 W Port Royale Lane Peoria 85381
  26. 3291 S Woodbine Court Gold Canyon 85118
  27. 14227 W Shaw Butte Drive Surprise 85379
  28. 22232 N 29th Drive Phoenix 85027
  29. 3156 S Jacaranda Court Gold Canyon 85118
  30. 2730 E Terrace Avenue Gilbert 85234
  31. Palm Valley homes
  32. Homes in Desirable Litchfield Park and Goodyear area Great Schools
  33. Why You Shouldn’t Wait!
  34. Agent Login

H3 Headings

4 :
  1. Quick Search
  2. Deb's Featured Listings
  3. Sign Up for an Account
  4. Why Sign Up?

H4 Headings

6 :
  1. Search For Homes
  2. Featured Communities
  3. Real Estate News
  4. Communities
  5. Real Estate News
  6. Contact Info

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

79 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-83696955-11

Links - Internal (nofollow)

0:

Links - Outbound

101:

Links - Outbound (nofollow)

4:

Keyword Cloud for Debcharlesworthrealtor.us

centermode false centerpadding6realtygreatbroker opendoor brokerageopendoorvalley homeswmountainhomes for salevarone group virtualllc virtualestatevirtualgroupsqftbroker opendoorallberkshire25 sqftonelitchfield parkgroup virtual touryour3 baths7homeservices arizonaopendoor brokerage5litchfieldgoldsale3 baths 2broker realtydrivepark and goodyearpropertiesbaths 25 sqft3 baths 25baths 3real estatebaths 3 sqftllcvalleyfalse centerpaddingbrokeragesearch3 sqftbaths 2arizonaopendoor brokerage llcdesirablerealty virtualavenuefalse4 baths 25bedrooms 3x02026realty one groupbrokerrealmoreparkpropertyphoenixrealty onepalm valleyinformation4hathaway homeservices arizonabrokerage llc03palmone groupvirtual tourschools2 baths 2scottsdalex02026 readwestcanyonberkshire hathaway homeservicesnewhathawaycreeklaneproperties virtual toursurprisecentermode falsemesasun4 baths 3new listingemail4 bathsbedrooms 2 bathshomeservices arizona propertiesreadearizona properties virtualhomeshillsbedrooms 3 bathscenterpaddingfunctionbedroomsloginhomebaths 2 sqfttourbathsgilbertarizona propertiesstreetbroker berkshire hathawayaccountgoodyear1sannllc virtual tourbroker berkshirebedrooms 2mlsyoubaths 25centermodebrokerage llc virtualberkshire hathaway2 bathsgroup virtualpalm valley homeslistingrealty virtual tour29x000b7bedrooms 4great schools10bedrooms 4 baths8gold canyonhomeservicesucb2 sqfthathaway homeservicesproperties virtualbroker realty onecity

Longtail Keyword Density for Debcharlesworthrealtor.us

KeywordsOccurences
homes for sale12
bedrooms 3 baths11
baths 2 sqft8
baths 3 sqft7
bedrooms 4 baths6
baths 25 sqft6
llc virtual tour6
3 baths 25
brokerage llc virtual4
broker opendoor brokerage4
opendoor brokerage llc4
realty virtual tour4
realty one group4
hathaway homeservices arizona3
homeservices arizona properties3
3 baths 253
arizona properties virtual3
berkshire hathaway homeservices3
properties virtual tour3
broker berkshire hathaway3
park and goodyear3
group virtual tour3
one group virtual3
broker realty one3
4 baths 33
2 baths 23
bedrooms 2 baths3
4 baths 253
palm valley homes3
centermode false centerpadding3
virtual tour24
bedrooms 311
3 baths11
2 sqft8
baths 28
litchfield park7
3 sqft7
new listing7
baths 37
bedrooms 46
4 baths6
baths 256
25 sqft6
llc virtual6
palm valley5
real estate4
brokerage llc4
one group4
realty one4
opendoor brokerage4
broker opendoor4
realty virtual4
gold canyon3
centermode false3
x02026 read3
great schools3
properties virtual3
arizona properties3
homeservices arizona3
berkshire hathaway3
hathaway homeservices3
broker berkshire3
valley homes3
group virtual3
bedrooms 23
broker realty3
2 baths3
false centerpadding3
sale26
tour24
bedrooms24
baths24
sqft24
mls24
broker24
virtual24
homes19
018
valley13
112
w11
realty11
listing10
litchfield10
park9
new9
phoenix9
var9
27
36
drive6
street6
e6
group6
n6
46
56
false6
llc6
home6
arizona6
one6
palm5
function5
goodyear5
avenue5
city5
properties4
estate4
real4
brokerage4
opendoor4
login4
canyon4
creek4
great4
search4
you4
information4
gilbert4
email4
schools3
x020263
centermode3
property3
63
read3
desirable3
73
x000b73
your3
account3
lane3
all3
scottsdale3
83
93
103
mountain3
surprise3
west3
sun3
san3
homeservices3
mesa3
gold3
hills3
ucb3
more3
berkshire3
hathaway3
centerpadding3

Who hosts Debcharlesworthrealtor.us?

Debcharlesworthrealtor.us Hosting Provider Information

Hosted IP Address:184.168.131.241
Hosted Hostname:ip-184-168-131-241.ip.secureserver.net
Service Provider:AS-26496-GO-DADDY-COM-LLC
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:sitedistrict-nginx

Is "AS-26496-GO-DADDY-COM-LLC" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.7948%
GoDaddy.com, LLC
8.0700%
Namecheap, Inc.
4.0119%
Confluence Networks Inc
2.6770%
Fara Negar Pardaz Khuzestan
2.1305%
Google Inc.
2.1184%
Merit Network Inc.
1.8272%
1&1 Internet AG
1.8076%
Cogent Communications
1.7178%
CloudFlare, Inc.
1.6296%
%

HTTP Header Analysis for Debcharlesworthrealtor.us

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 04 May 2021 22:20:20 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Link:; rel="https://api.w.org/"
X-Server: sitedistrict
X-Host-Cache: MISS
x-content-type-options: nosniff
strict-transport-security: max-age=21600
x-xss-protection: 1; mode=block
Content-Encoding: gzip
Server: sitedistrict-nginx
X-Proxy-Cache: MISS
X-Proxy-Server: proxy-17

Debcharlesworthrealtor.us Domain Nameserver Information

HostIP AddressCountry
ns64.domaincontrol.com 173.201.69.42
ns63.domaincontrol.com 97.74.101.42


Need to find out who hosts Debcharlesworthrealtor.us?


Domain Registration (WhoIs) information for Debcharlesworthrealtor.us

 Domain Name: debcharlesworthrealtor.us
Registry Domain ID: D0998C85B227048428049CB0E12C4D5AC-NSR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: whois.godaddy.com
Updated Date: 2019-09-10T22:48:23Z
Creation Date: 2019-09-05T22:48:18Z
Registry Expiry Date: 2021-09-05T22:48:18Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Registry Registrant ID: C241976D7D04A4A2DA1FA6E5576944D26-NSR
Registrant Name: Debbie Charlesworth
Registrant Organization: Real Estate
Registrant Street: 4539 N Clear Creek Dr
Registrant Street:
Registrant Street:
Registrant City: Litchfield Park
Registrant State/Province: Arizona
Registrant Postal Code: 85340
Registrant Country: us
Registrant Phone: +1.6025315165
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Application Purpose: P1
Registrant Nexus Category: C21
Registry Admin ID: CF0D1FA4F8FD6442290EE1A76FA70F880-NSR
Admin Name: Debbie Charlesworth
Admin Organization: Real Estate
Admin Street: 4539 N Clear Creek Dr
Admin Street:
Admin Street:
Admin City: Litchfield Park
Admin State/Province: Arizona
Admin Postal Code: 85340
Admin Country: us
Admin Phone: +1.6025315165
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Application Purpose: P1
Admin Nexus Category: C21
Registry Tech ID: CE1C1CDB047BC43618A0525CF78E2D2A5-NSR
Tech Name: Debbie Charlesworth
Tech Organization: Real Estate
Tech Street: 4539 N Clear Creek Dr
Tech Street:
Tech Street:
Tech City: Litchfield Park
Tech State/Province: Arizona
Tech Postal Code: 85340
Tech Country: us
Tech Phone: +1.6025315165
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Application Purpose: P1
Tech Nexus Category: C21
Name Server: ns64.domaincontrol.com
Name Server: ns63.domaincontrol.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-05-04T22:20:20Z

Websites with Similar Names

Debcha.org
Debbie Chachra
Debchakko.com
Keller Williams
Debcharlesworthrealtor.com
Litchfield Park and Goodyear Specialist
Debcharlesworthrealtor.us
Litchfield Park and Goodyear Specialist
Debchase.com
DebChase | Marketing & Content Strategy
Debcheck.org
Easy And safe way to check debit card balance
Debcheslow.com
Cheslow Achievement Group – Inspired Strategies, Remarkable Results
Debchevie.com
Site Unavailable
Debchowdhury.com
32 Real Estate Leads Costing $42 - Do You Want Similar Results?

Recently Updated Websites

Jptech-services.com (2 seconds ago.)Mcmc-reynolds.com (3 seconds ago.)Ubezpieczony.online (3 seconds ago.)82havelockstreet.com (3 seconds ago.)Letstryanalsex.com (3 seconds ago.)Dulceamaranto.com (4 seconds ago.)Madeinhugh.com (4 seconds ago.)Hiresara.org (5 seconds ago.)Askmehelpdesk.com (5 seconds ago.)Tuesteticaonline.com (6 seconds ago.)Coolrunningtasmania.online (6 seconds ago.)Centreleonardodavinci.com (6 seconds ago.)Thenexthomeforyou.com (7 seconds ago.)Alzughaibi.com (7 seconds ago.)Electiontrust.com (7 seconds ago.)Supportcamh.ca (7 seconds ago.)Yep4life.com (8 seconds ago.)Valentinemingle.club (8 seconds ago.)Metalship.org (8 seconds ago.)Mhzgo.com (9 seconds ago.)Swirlphx.com (9 seconds ago.)Donthurtpuppies.com (9 seconds ago.)Typeset.pro (9 seconds ago.)Buyprotectdirect.com (9 seconds ago.)Trumpetoftruthonline.org (9 seconds ago.)We7code.com (10 seconds ago.)Izichinese.com (11 seconds ago.)Inthebalanceoflove.com (11 seconds ago.)Adbien.com (11 seconds ago.)9727englishpinewindermere.com (11 seconds ago.)

Recently Searched Keywords

美味的广场 (1 second ago.)escrever (5 seconds ago.)linkedin (6 seconds ago.)grammy.com (7 seconds ago.)ab t6e 4a4 (8 seconds ago.)acquisition definition (9 seconds ago.)style-kbfiwudq2icon (12 seconds ago.)bandi-painting (13 seconds ago.)www.c40reinventingcities.org (14 seconds ago.)replaced thisplaceholderinterval setintervalfunction (17 seconds ago.)style-jwt3ir1mmenucontainerarrow (21 seconds ago.)bbwcupidcom (23 seconds ago.)confront (23 seconds ago.)hehe emoji (25 seconds ago.)sqs-album-minimal (26 seconds ago.)set regular price (29 seconds ago.)seznam.cz (31 seconds ago.)pocoo (32 seconds ago.)обновление прошивки получите новую прошивку для всех продуктов smart hd (36 seconds ago.)explorewith4paws (38 seconds ago.)8 499 394-42-08 (38 seconds ago.)50px importantfont-weight 600 (38 seconds ago.)king talent viet nam (41 seconds ago.)urssaf versement transport 2020 effectif (41 seconds ago.)savory spice (44 seconds ago.)okragly po ang (50 seconds ago.)тент 3.2*1.8*1.8 (52 seconds ago.)prodata (55 seconds ago.)aliquam facilisis ante (57 seconds ago.)property fells (1 minute ago.)