deejay.de - All News

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 91,846
Estimated Worth: $164,160
Last updated:2020-11-04
Category: Shopping > Music

deejay.de - All News


Domain summary

Domain label
deejay
Domain extension
de
Global Traffic Rank
91,846
Statvoo Rating
E
Trust Score
Low Trust Score
Estimated worth
$164,160
Estimated daily income
$228
Estimated monthly income
$6,935

Rank summary

How is deejay.de ranked relative to other sites:

Percentage of visits to deejay.de from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Deejay.de registered?
A: Deejay.de was registered 3 months, 3 weeks, 16 hours, 58 minutes, 50 seconds ago on Wednesday, November 4, 2020.
Q: When was the WHOIS for Deejay.de last updated?
A: The WHOIS entry was last updated 2 years, 1 month, 2 weeks, 4 days, 16 hours, 58 minutes, 50 seconds ago on Monday, January 7, 2019.
Q: What are Deejay.de's nameservers?
A: DNS for Deejay.de is provided by the following nameservers:
  • ns1.mm-com.de
  • ns2.mm-com.de
Q: Who is the registrar for the Deejay.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Deejay.de?
A: Deejay.de ranks 91,846 globally on Alexa. Deejay.de has a Low Trust Score, and a Statvoo Rank of E.
Q: How many people visit Deejay.de each day?
A: Deejay.de receives approximately 18,977 visitors and 113,862 page impressions per day.
Q: What IP address does Deejay.de resolve to?
A: Deejay.de resolves to the IPv4 address 62.154.254.195.
Q: In what country are Deejay.de servers located in?
A: Deejay.de has servers located in the Germany.
Q: What webserver software does Deejay.de use?
A: Deejay.de is powered by Apache webserver.
Q: Who hosts Deejay.de?
A: Deejay.de is hosted by Deutsche Telekom AG in North Rhine-westphalia, Lage, Germany, 32791.
Q: How much is Deejay.de worth?
A: Deejay.de has an estimated worth of $164,160. An average daily income of approximately $228, which is roughly $6,935 per month.

Deejay.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Deejay.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Deejay.de

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

4 :
  1. Vinyl Distribution
  2. DJ Equipment
  3. Voucher(s)
  4. Pay & Ship

H4 Headings

1 :
  1. Feel free to contact us:

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

4 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

46:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Deejay.de

function ifdirxhr falsenullsearchliste tablethiswidth pxthiswidthkeycontentphpparam thisattrhref return1returnfunction e epreventdefaultsessionstorageremoveitemsearchlistethisattrhref returnif sessionstoragegetitemfilteropenvarhref elattrhrefreplacewatcharticle stockmailcurrenthashsubstr0currenthashsubstr1innermainfunctionmyiframeattrsrc contentphpparaminitcookiebannersearch1 currenthashif xhrmyiframeattrsrcelattrhrefreplacewatcharticle stockmailtopdocumentcsswidth thiswidthsearchliste topdocumenthtmlslideupalltopdocumentcsswidth thiswidth px0 myiframedocument returnsearchlistehtmlslideupxhrabortepreventdefaulteif sessionstoragegetitemfilteropen nullsmartphonefunction varxhrabort xhr falsethisattrhref return falseftautocompleteajaxhref elattrhrefstockmailbreakvar eldocument return falsesuccess functioncurrenthashsubstr0 12if thisvalif currenthashsubstr0pxplayerdivupdatecartthis documentfunction searchlistehtmlslideupdocumentnotesessionstoragegetitemfilteropen nullifsessionstoragesetitemfilteropen filterdefaultfilterdefaulteventelhrefe epreventdefaultcollapsablestateelattrhrefreplacewatcharticlereturn falseelsecartpreviewkeycode 32xhr3currenthashsubstr0 1 currenthashhref elattrhrefreplacewatcharticlesearchvalsmartphone playerdivsuccesscurrenthash currenthashsubstr1sessionstorageremoveitemthisattrhrefeventpreventdefaultif xhr xhrabortdownxhr xhrabortcontactchoicesessionstoragegetitemfilteropendataxhr xhrabort xhre epreventdefault ifslideoutmainmenuanotnomodunbindclickbindclick functionpx ifli ul litopdocumenthtmlslideup0thisvalnull sessionstoragesetitemfilteropen filterdefaultthisattrhrefsearchlistehtmlslideup updatecartthisnull sessionstoragesetitemfilteropenif currenthashsubstr0 1cartlitopdocumentcsswidthanotnomodunbindclickbindclicksessionstorageremoveitem thisattrhreffunction eajax typeepreventdefault ife epreventdefault searchlistehtmlslideupcurrenthashmyiframeurlcontentphpparamxhrabort xhrupdatecartthisul lisessionstoragesetitemfilteropenlastsearchtypecontentphpparam thisattrhrefli ulelattrhrefsessionstoragegetitemfilteropen null sessionstoragesetitemfilteropenkeycodeanotnomodunbindclickbindclick function eepreventdefault searchlistehtmlslideupfalseidcasemyiframeattrsrc contentphpparam thisattrhref1 currenthash currenthashsubstr1tableul

Longtail Keyword Density for Deejay.de

KeywordsOccurences
function e epreventdefault11
href elattrhrefreplacewatcharticle stockmail4
e epreventdefault if4
if xhr xhrabort4
xhr xhrabort xhr4
xhrabort xhr false4
myiframeattrsrc contentphpparam thisattrhref4
document return false4
thisattrhref return false4
e epreventdefault searchlistehtmlslideup4
if sessionstoragegetitemfilteropen null3
1 currenthash currenthashsubstr13
li ul li3
contentphpparam thisattrhref return3
currenthashsubstr0 1 currenthash3
if currenthashsubstr0 13
sessionstoragegetitemfilteropen null sessionstoragesetitemfilteropen3
anotnomodunbindclickbindclick function e3
null sessionstoragesetitemfilteropen filterdefault3
topdocumentcsswidth thiswidth px3
function e13
return false12
e epreventdefault11
href elattrhref9
xhr false7
updatecartthis document5
if xhr5
href elattrhrefreplacewatcharticle4
elattrhrefreplacewatcharticle stockmail4
thisattrhref return4
contentphpparam thisattrhref4
document return4
myiframeattrsrc contentphpparam4
sessionstorageremoveitem thisattrhref4
xhrabort xhr4
function searchlistehtmlslideup4
epreventdefault if4
ul li4
epreventdefault searchlistehtmlslideup4
thiswidth px4
xhr xhrabort4
if sessionstoragegetitemfilteropen3
smartphone playerdiv3
function if3
currenthash currenthashsubstr13
li ul3
0 myiframe3
searchlistehtmlslideup updatecartthis3
success function3
1 currenthash3
currenthashsubstr0 13
if currenthashsubstr03
searchliste topdocumenthtmlslideup3
if thisval3
px if3
sessionstoragegetitemfilteropen null3
ajax type3
keycode 323
var el3
function var3
anotnomodunbindclickbindclick function3
searchliste table3
sessionstoragesetitemfilteropen filterdefault3
null sessionstoragesetitemfilteropen3
topdocumentcsswidth thiswidth3
if42
function34
var22
false21
searchlistehtmlslideup15
e15
xhr14
href13
return12
epreventdefault11
searchliste10
else10
elattrhref9
thisattrhref9
document9
keycode9
px9
07
li7
17
updatecartthis6
state5
myiframe5
searchval5
25
contentphpparam5
data5
currenthash5
id5
ul5
innermain5
playerdiv4
key4
type4
filterdefault4
34
smartphone4
cartpreview4
sessionstorageremoveitem4
stockmail4
topdocumentcsswidth4
elattrhrefreplacewatcharticle4
event4
thiswidth4
myiframeattrsrc4
xhrabort4
thisval4
contact3
dir3
initcookiebanner3
slideoutmainmenu3
note3
currenthashsubstr13
ftautocomplete3
currenthashsubstr03
break3
all3
sessionstoragegetitemfilteropen3
null3
sessionstoragesetitemfilteropen3
eventpreventdefault3
case3
down3
table3
anotnomodunbindclickbindclick3
topdocumenthtmlslideup3
sessionstorageremoveitemthisattrhref3
collapsable3
search3
lastsearch3
cart3
el3
ajax3
url3
success3
choice3

Who hosts Deejay.de?

Deejay.de Hosting Provider Information

Hosted IP Address:62.154.254.195
Hosted Hostname:www.deejay.de
Service Provider:Deutsche Telekom AG
Hosted Country:GermanyDE
Location Latitude:51.9922
Location Longitude:8.793
Webserver Software:Apache

Is "Deutsche Telekom AG" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
Deutsche Telekom AG
0.0127%

HTTP Header Analysis for Deejay.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 04 Nov 2020 04:38:27 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: max-age=600, private, must-revalidate
Pragma: no-cache
Content-Security-Policy: frame-ancestors https://*.deejay.de https://*.vinylfuture.com;
X-Content-Security-Policy: frame-ancestors https://*.deejay.de https://*.vinylfuture.com;
X-WebKit-CSP: frame-ancestors https://*.deejay.de https://*.vinylfuture.com;
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Deejay.de Domain Nameserver Information

HostIP AddressCountry
ns1.mm-com.de 193.159.244.186Germany Germany
ns2.mm-com.de 62.154.254.206Germany Germany


Need to find out who hosts Deejay.de?


Domain Registration (WhoIs) information for Deejay.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: deejay.de
Nserver: ns1.mm-com.de
Nserver: ns2.mm-com.de
Status: connect
Changed: 2019-01-07T08:48:35+01:00

Websites with Similar Names

Deeja.net
ดีจ้าดอทเน็ต
Deejaavoo.de
Home - guttenberger+partner Lichtwerbung GmbH
Deejacosmetic.com
Deeja Cosmetic – Haruslah Deeja
Deejadafashion.cz
ACTIVE 24, s.r.o.
Deejadams.com
Dee J. Adams | Dee J. Adams, romantic suspense author
Deejaden.us
DeeJaden Herbal Clinic – Live Healthy Always

Recently Updated Websites

Ethyls.com (2 seconds ago.)Sandalcreations.com (8 seconds ago.)Redcedar.jp (11 seconds ago.)Essaysonline.org (13 seconds ago.)Createdentity.com (14 seconds ago.)Eendjehuren.com (15 seconds ago.)Inosbg.com (16 seconds ago.)Iesollosgrandes.org (17 seconds ago.)Tehiku.co.nz (18 seconds ago.)4gamesonline.ru (19 seconds ago.)Tastyexperts.com (20 seconds ago.)Lyogreen.org (22 seconds ago.)Techelse.info (23 seconds ago.)Mm-eem.com (23 seconds ago.)Lylongrun.com (25 seconds ago.)Printer-refills.net (25 seconds ago.)Annataylordesign.com (26 seconds ago.)Makeinusa.us (29 seconds ago.)Trafficticketlawyer-syracuse-ny.com (30 seconds ago.)Billionfoods.com (30 seconds ago.)Bitcoincoin.online (31 seconds ago.)Mobilenetx.com (34 seconds ago.)Enchantingprincessevents.com (34 seconds ago.)Aeqstudio.xyz (39 seconds ago.)Dependablecamperrentals.com (39 seconds ago.)Onksh.com (40 seconds ago.)Kumbhat.com (40 seconds ago.)Poochlearning.info (41 seconds ago.)Myprosegur.de (41 seconds ago.)Sngnederland.nl (41 seconds ago.)

Recently Searched Keywords

philips hand blender (1 second ago.)fusion-content-boxes-6 (6 seconds ago.)mergefit true autoheight (21 seconds ago.)$3 gold princess (23 seconds ago.)nike free 5.0 v2 (28 seconds ago.)700pxleft calc50 (39 seconds ago.)→ günstiges webhosting in der schweiz (44 seconds ago.)revapi28 (53 seconds ago.)dos plantas (56 seconds ago.)jqueryorigincodeslideshowdotsvideogallery3removeclassorigincodeslideshowdotsactivevideogallery3addclassorigincodeslideshowdotsdeactivevideogallery3 jqueryorigincodedots origincodecurrentkeyvideogallery3 (1 minute 1 second ago.)tickling meaning in urdu (1 minute 2 seconds ago.) - adidas campus (1 minute 10 seconds ago.)тепличная пленкав рулонах и на любой метраж (1 minute 10 seconds ago.)kakao встряска (1 minute 13 seconds ago.)h s (1 minute 18 seconds ago.)chakra (1 minute 19 seconds ago.)vaudrapi (1 minute 21 seconds ago.)dolne wicejnbspnbspnbsp (1 minute 31 seconds ago.)fusion-column-wrapper (1 minute 36 seconds ago.)2t (brentwood) 7:00 am (1 minute 38 seconds ago.)d-poker (1 minute 39 seconds ago.)authentic hotel split (1 minute 46 seconds ago.)wi (1 minute 48 seconds ago.) (1 minute 49 seconds ago.)elementdefinitionextend initialize (1 minute 50 seconds ago.)jqueryorigincodeslideshowdotsvideogallery3removeclassorigincodeslideshowdotsactivevideogallery3addclassorigincodeslideshowdotsdeactivevideogallery3 jqueryorigincodedots origincodecurrentkeyvideogallery3 (1 minute 51 seconds ago.)child model (1 minute 51 seconds ago.)tin viec lam tphcm (1 minute 52 seconds ago.)child model (1 minute 53 seconds ago.)twee (1 minute 55 seconds ago.)