Defense.govDefense.gov

U.S. Department of Defense

Safety: High trust score

Year Founded: 2022

Global Traffic Rank: 1,990

Estimated Worth: $8,119,440

Category: Law and Government > Military and Defense

Expand details Change category Claim this site

The Department of Defense is America's largest government agency. Our mission is to provide the military forces needed to deter war and ensure our nation's security.

defense, defense, defense department, department of defense, dod, secretary, deputy secretary, joint chief, united states, military, government, pentagon, secretary of defense, deputy secretary of defense

Useful Searches

Domain summary

Last updated	2022-01-06
Domain label	defense
Domain extension	gov
Global Traffic Rank	1,990
Statvoo Rating	B
Trust Score	High trust score
Estimated worth	$8,119,440
Estimated daily income	$7,518
Estimated monthly income	$228,673

Frequently Asked Questions (FAQ)

Q: When was Defense.gov registered?

A: Defense.gov was registered 4 months, 2 weeks, 2 days, 17 hours, 50 minutes, 13 seconds ago on Thursday, January 6, 2022.

Q: When was the WHOIS for Defense.gov last updated?

A: The WHOIS entry was last updated 4 months, 2 weeks, 2 days, 17 hours, 50 minutes, 13 seconds ago on Thursday, January 6, 2022.

Q: What are Defense.gov's nameservers?

A: DNS for Defense.gov is provided by the following nameservers:

use2.akam.net
ns1-95.akam.net
ns1-116.akam.net
use9.akam.net
eur6.akam.net
asia3.akam.net
asia2.akam.net
usc5.akam.net

Q: Who is the registrar for the Defense.gov domain?

A: The domain has been registered at .

Q: What is the traffic rank for Defense.gov?

A: Defense.gov ranks 1,990 globally on Alexa. Defense.gov has a High trust score, and a Statvoo Rank of B.

Q: How many people visit Defense.gov each day?

A: Defense.gov receives approximately 939,698 visitors and 7,517,584 page impressions per day.

Q: What IP address does Defense.gov resolve to?

A: Defense.gov resolves to the IPv4 address .

Q: In what country are Defense.gov servers located in?

A: Defense.gov has servers located in the .

Q: What webserver software does Defense.gov use?

A: Defense.gov is powered by webserver.

Q: Who hosts Defense.gov?

A: Defense.gov is hosted by Unknown in .

Q: How much is Defense.gov worth?

A: Defense.gov has an estimated worth of $8,119,440. An average daily income of approximately $7,518, which is roughly $228,673 per month.

Defense.gov Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Defense.gov Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Defense.gov

H1 Headings

1 :

U.S. Department of Defense

H2 Headings

9 :

Austin Looking Forward to Discussions With Japanese Counterpart
News
Press Products
From The Services
Interactive Experiences
Experience DOD
DOD in Photos: 2021
Tomb of the Unknown Soldier
Four-Legged Fighters

H3 Headings

22 :

Coronavirus: DOD Response
Tackling the Climate Crisis
Secretary of Defense Lloyd J. Austin III
U.S. Troops in Iraq Remain at Risk, Retain Right of Self-Defense, Press Secretary Says
Face of Defense: Teaching Young Athletes to 'Unite and Believe'
Military Health
Sunny Anderson, Former Air Force Broadcaster, Now a Food Network Star
Stars Behind the Stripes
Readout of Secretary of Defense Lloyd J. Austin III's Call With Russian Minister of Defense Sergey Shoygu
Readout of Secretary of Defense Lloyd J. Austin III's Call With U.K. Secretary of State for Defense Ben Wallace
Pentagon Press Secretary John Kirby Holds an Off-Camera Press Briefing
Soldiers Prepare for Middle East Deployment
F-35C Squadron Makes Marine Corps History
USS Constitution Gets First Female Commander
Culture App Features New Courses on China, Russia
Space Force Launches New Public Website
Maryland Guard Activated for COVID-19 Emergency
Multimedia
Defense.gov
Helpful Links
Resources
Popular

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

21 :

Google Adsense

Not Applicable

Google Analytics

Not Applicable

Links - Internal

107:

Show 102 more items

Links - Internal (nofollow)

Links - Outbound

23:

Show 18 more items

Links - Outbound (nofollow)

Keyword Cloud for Defense.gov

experiencesliderwrappeopleisdvidsslideitemfeatureisvideo slideindex slideindexyour militarylloyd jifhandles multipletitleslideindex slideidyourunknown virin nullfunction emakesjson stylebehindshowamericanuseoverlaybyline marine corpspentagon pressjson style twoisyoutube false slideindextokens that helpknowcasewhilepetty officer 2ndarpartsstoriesget somewidthcoronavirus dod responsenested structure convertneeded data such0marshalling the datanavyfalse isyoutube falsejdata marshallingmaxwidthlittlesgtiii39sstartprogressbarsecuritychairmanvideodurationpress secretary johnjapannumslidesfalse datapreventdistortionclass titlewidehistoryisvideo isvideo2022 primarywidthfighthandles multiple settingsmarshallingfoodreadout of secretary8submitsearchthispentagon press secretaryelseallcenginedata one advantagedefensepentagonmissionsfunctionnextarrowcurrentlyend of itemvirin nullrightdata oneaustin iii39s callairmansunnyvideodate unknowntarget self imageurlaustinfalse isyoutubelivepressuseoverlay useoverlayunknownhandleshealthisdvids false isyoutubeuseoverlay falsebyline airreturnprimaryheightslideindex slidespushslideitemmultiplemore eventsend2021 primarywidthcoronavirus dodproductscrisisslideindex slideindex slideidevents currentlyconverttemplate footeraltussome tokensbasetrue isvideo falseaustin iii39suseoverlay useoverlay isvideogetdateformatitembeginnbsp itemtitleussadvantage a littlehis1210officerlanceface3 2022 primarywidthdata suchconditionalisdvids falseknow yourhavesnowstripesforce spaceneeded dataslideindexstaffnationalchiefsarvalsecretarymarshalling it wouldslidesseaspotlightsmediacontent videodurationconditional slideitem linkexperiencesnotstateisyoutube falsesnowballcompetitionmarine corps lancenavy petty officerfalse isdvidshighfalse data marshallingfootercplprimaryheight 511 serverindexfalse slideindex slidespushslideitemcallself imageurlspotlighteventsfalse isdvids falsenestedclimatenull booleansprimaryheight 511austin iiivideos765 primaryheight2511 serverindexresponse6convert to jsonnewsitscorps lancefalse videoduration falseuseoverlay false isvideobylineforce space forcenavy pettypettyfalse slideindex2021 primarywidth 765slideindex slidespushslideitem endunknown virinpetty officermultiple settingsprimarywidth 765 primaryheightfalse videodurationcockpitservicesjannullisimage trueisyoutubeuseoverlay isvideo isvideoget some tokensdepartment of defenseclearer and handlesj austin iii39stroopshelp injectvideoduration videodate unknownfooter templateisimageletslidecounttacklingisimage true isvideostructure convert11heightinject the neededjan 3 2022duringprevarrow nextarrowstyle twofalsesnowball fightisvideo isvideo slideindexnice to getmissionofficer 2nd classforceandersonlinktokenspress productsitem template footersecretary johnsuchstarshastombnull booleans isimagebooleans isimageitemcorpsserverhiresimageurlbuilding in ctemplateconstreadyvideoduration falsecoronaviruscomponentstheirtackling the climateconditional slideitemisvideo false isdvidsaboard the usscoverreadaspectratioitemtitlenumcolstrue isvideobreakhelpaffiliateprimarywidth 765advantagedefaultcorps lance cplunknown soldierclassdescription navy0 arpartsinteractive experiences7defense lloydjsonslidespushslideitemduring a competitiontruenicephotos videossecretary of defensetemplate useoverlay falsemediacontentlance cplwindowmatchmediaminwidthj austinmilitary healthbyline marinenowair forcegstargetwouldmorereadoutlittle clearerkirbyneededsearchstylestructurespace forcetemplate useoverlaynumrowsclearertwodescriptiongetdateformatitembeginnbspprimaryheight 510videoduration false datadefense department2nd classministerinteractivemultiple settings linesslidespushslideitem endvartemplate footer templatepress secretarylloyd j austinc as nestedvideoduration videodateimageurlprimaryheight 510 serverindexfooter template useoverlaysecretary of state3 2022japaneselloydisvideo falseprevarrowclimate crisisvideodateisvideo slideindexspaceplaceslideidskinvarsaidiii39s callathletes2ndone advantagebooleansarmytarget selfiraqpreventdistortionclass4supportdodnested structurefalse isvideo falseforcesmediacontent videoduration videodateread moreitem templatedatamarinetheysunny andersonselfaboardisvideowould be niceguardbooleans isimage truefalse isvideoj austin iiipreparejointofficer 2ndretainairdotsserverindexvirinnewtargetgetsoldierslideindex slideindexlines in conditional9lineselse ifdepartment1photostwo for marshallingmilitarychiefs of staffeprimarywidthciviliandefense lloyd jnational guardface of defensevirin null booleansisvideo false videodurationfademarine corpsslideitem linkjohn3alt twodod responsejoint chiefsmultimedia5settingsfunction returnjan 3service510 serverindex2022 primarywidth 765buildingvideodate unknown virinsuch as buildingbyline air forceinputnamefootersearchsomeuseoverlay isvideo765 primaryheight 510oneknow your militarydecinjectiiisettings lines

Longtail Keyword Density for Defense.gov

Keywords	Occurences
secretary of defense	14
marshalling the data	13
lines in conditional	12
slideindex slidespushslideitem end	12
isvideo isvideo slideindex	12
useoverlay isvideo isvideo	12
useoverlay useoverlay isvideo	12
target self imageurl	12
conditional slideitem link	12
handles multiple settings	12
multiple settings lines	12
clearer and handles	12
advantage a little	12
data one advantage	12
two for marshalling	12
json style two	12
isvideo slideindex slideindex	12
slideindex slideindex slideid	12
nested structure convert	12
false slideindex slidespushslideitem	12
isyoutube false slideindex	12
false isyoutube false	12
mediacontent videoduration videodate	12
videoduration videodate unknown	12
videodate unknown virin	12
unknown virin null	12
virin null booleans	12
null booleans isimage	12
booleans isimage true	12
isimage true isvideo	12
true isvideo false	12
isvideo false isdvids	12
convert to json	12
building in c	12
c as nested	12
videoduration false data	12
template footer template	12
item template footer	12
end of item	12
isdvids false isyoutube	12
useoverlay false isvideo	12
false isvideo false	12
isvideo false videoduration	12
false videoduration false	12
template useoverlay false	12
false data marshalling	12
inject the needed	12
marshalling it would	12
such as building	12
needed data such	12
false isdvids false	12
tokens that help	12
get some tokens	12
nice to get	12
would be nice	12
footer template useoverlay	11
primarywidth 765 primaryheight	8
lloyd j austin	8
defense lloyd j	8
primaryheight 510 serverindex	8
765 primaryheight 510	6
jan 3 2022	5
3 2022 primarywidth	5
petty officer 2nd	4
officer 2nd class	4
byline marine corps	4
navy petty officer	4
department of defense	4
primaryheight 511 serverindex	4
2022 primarywidth 765	4
tackling the climate	4
face of defense	4
chiefs of staff	4
j austin iii	4
readout of secretary	4
j austin iii39s	4
austin iii39s call	4
coronavirus dod response	4
2021 primarywidth 765	4
know your military	3
press secretary john	3
pentagon press secretary	3
aboard the uss	3
secretary of state	3
force space force	3
marine corps lance	3
corps lance cpl	3
during a competition	3
byline air force	3
isvideo false	24
air force	13
item template	13
useoverlay isvideo	13
one advantage	12
template footer	12
slideitem link	12
conditional slideitem	12
settings lines	12
multiple settings	12
handles multiple	12
little clearer	12
json style	12
data one	12
style two	12
self imageurl	12
structure convert	12
nested structure	12
data such	12
needed data	12
help inject	12
target self	12
preventdistortionclass title	12
slideindex slidespushslideitem	12
virin null	12
isyoutube false	12
false isyoutube	12
isdvids false	12
false isdvids	12
true isvideo	12
isimage true	12
booleans isimage	12
null booleans	12
unknown virin	12
useoverlay useoverlay	12
videodate unknown	12
videoduration videodate	12
mediacontent videoduration	12
slidespushslideitem end	12
slideindex slideid	12
slideindex slideindex	12
isvideo slideindex	12
isvideo isvideo	12
some tokens	12
get some	12
data marshalling	12
template useoverlay	12
marine corps	12
false data	12
footer template	12
false slideindex	12
useoverlay false	12
false isvideo	12
videoduration false	12
false videoduration	12
j austin	8
lloyd j	8
765 primaryheight	8
primarywidth 765	8
2022 primarywidth	8
primaryheight 510	8
510 serverindex	8
defense lloyd	8
function return	6
coronavirus dod	5
space force	5
3 2022	5
else if	5
jan 3	5
press secretary	5
byline marine	4
austin iii39s	4
0 arparts	4
dod response	4
climate crisis	4
joint chiefs	4
iii39s call	4
2021 primarywidth	4
navy petty	4
petty officer	4
officer 2nd	4
austin iii	4
511 serverindex	4
primaryheight 511	4
2nd class	4
corps lance	3
alt two	3
description navy	3
snowball fight	3
lance cpl	3
press products	3
byline air	3
more events	3
interactive experiences	3
force space	3
national guard	3
defense department	3
read more	3
prevarrow nextarrow	3
events currently	3
getdateformatitembeginnbsp itemtitle	3
photos videos	3
pentagon press	3
secretary john	3
know your	3
your military	3
military health	3
sunny anderson	3
unknown soldier	3
function e	3
false	81
isvideo	49
data	38
useoverlay	37
slideindex	37
defense	32
template	26
marshalling	26
videoduration	25
function	25
const	25
link	24
true	24
secretary	22
force	22
if	19
air	16
var	16
unknown	15
return	15
two	15
title	14
military	14
corps	13
needed	13
slideitem	13
style	13
item	13
end	13
dod	13
numcols	13
marine	13
little	12
clearer	12
handles	12
multiple	12
advantage	12
settings	12
imageurl	12
lines	12
conditional	12
self	12
serverhiresimageurl	12
preventdistortionclass	12
slideid	12
byline	12
one	12
target	12
json	12
convert	12
structure	12
nested	12
c	12
description	12
such	12
inject	12
help	12
tokens	12
some	12
get	12
nice	12
would	12
0	12
building	12
alt	12
virin	12
primaryheight	12
null	12
isimage	12
footer	12
videodate	12
isdvids	12
mediacontent	12
serverindex	12
booleans	12
primarywidth	12
isyoutube	12
slidespushslideitem	12
press	11
department	11
1	11
austin	10
us	10
j	10
more	9
events	9
let	9
2	9
3	8
navy	8
4	8
jan	8
lloyd	8
5	8
news	8
climate	7
face	7
guard	7
arparts	7
else	7
6	7
all	6
coronavirus	6
during	6
7	6
aspectratio	6
stories	6
8	6
army	6
space	6
national	6
itemtitle	6
cpl	5
multimedia	5
width	5
now	5
9	5
response	5
e	5
aboard	5
uss	5
spotlight	5
live	5
iii	5
soldier	5
staff	5
photos	5
submitsearchthis	4
height	4
class	4
snow	4
2nd	4
cockpit	4
airman	4
dec	4
sgt	4
10	4
competition	4
sea	4
petty	4
officer	4
while	4
startprogressbar	4
tackling	4
crisis	4
call	4
iii39s	4
readout	4
spotlights	4
your	4
currently	4
chairman	4
has	4
joint	4
chiefs	4
health	4
search	4
his	4
japanese	4
new	4
john	4
minister	4
wide	4
break	4
case	4
troops	4
high	4
fade	4
arval	4
right	4
cover	4
feature	4
services	4
state	4
missions	3
dots	3
security	3
prevarrow	3
base	3
read	3
numslides	3
japan	3
civilian	3
components	3
support	3
experiences	3
interactive	3
videos	3
lance	3
products	3
engine	3
snowball	3
fight	3
skinvarsaid	3
inputnamefooter-search	3
place	3
nextarrow	3
mission	3
max-width	3
they	3
history	3
its	3
people	3
prepare	3
experience-slider-wrap	3
tomb	3
not	3
american	3
stripes	3
11	3
12	3
default	3
slides	3
numrows	3
slidecount	3
gstarget	3
makes	3
behind	3
show	3
know	3
getdateformatitembeginnbsp	3
iraq	3
retain	3
windowmatchmediamin-width	3
forces	3
pentagon	3
kirby	3
athletes	3
stars	3
have	3
ready	3
service	3
their	3
sunny	3
anderson	3
food	3
affiliate	3

Who hosts Defense.gov?

Defense.gov Hosting Provider Information

Hosted IP Address:	Not Applicable
Hosted Hostname:	Not Applicable
Service Provider:	Unknown
Hosted Country:	Not Applicable
Location Latitude:	Not Applicable
Location Longitude:	Not Applicable
Webserver Software:	Not Applicable

Is "Unknown" in the Top 10 Hosting Companies?

Name

Percentage

Unknown

21.9161%

GOOGLE

14.0532%

AS-26496-GO-DADDY-COM-LLC

3.4879%

NAMECHEAP-NET

3.1470%

AMAZON-AES

2.2136%

GoDaddy.com, LLC

2.0287%

UNIFIEDLAYER-AS-1

1.9645%

Fara Negar Pardaz Khuzestan

1.6143%

CONFLUENCE-NETWORK-INC

1.4660%

1&1 Internet AG

1.3358%

HTTP Header Analysis for Defense.gov

Http-Version:	1.1
Status-Code:	200
Status:	200 OK
Cache-Control:	no-cache,private
Pragma:	no-cache
Content-Type:	text/html; charset=utf-8
Expires:	-1
X-AspNetMvc-Version:
X-UA-Compatible:	IE=edge
pw_value:	3ce3af822980b849665e8c5400e1b45b
Access-Control-Allow-Origin:	*
X-XSS-Protection:	1; mode=block
X-Frame-Options:	SAMEORIGIN
X-Powered-By:
Server:
X-ASPNET-VERSION:
X-Content-Type-Options:	nosniff
Content-Encoding:	gzip
Content-Length:	33577
Date:	Thu, 06 Jan 2022 18:53:00 GMT
Connection:	keep-alive
Vary:	Accept-Encoding
Strict-Transport-Security:	max-age=31536000

Defense.gov Domain Nameserver Information

Host	IP Address	Country
use2.akam.net	96.7.49.64
ns1-95.akam.net	193.108.91.95
ns1-116.akam.net	193.108.91.116
use9.akam.net	72.246.46.65
eur6.akam.net	2.22.230.64
asia3.akam.net	23.211.61.64
asia2.akam.net	95.101.36.64
usc5.akam.net	96.7.50.65

Need to find out who hosts Defense.gov?

Domain Registration (WhoIs) information for Defense.gov

 % DOTGOV WHOIS Server ready
Domain Name: DEFENSE.GOV
Status: ACTIVE
Security Contact Email: Login to show email
 Last update of whois database: 2022-01-06T11:00:02Z

Websites with Similar Names

Defen.com
Buy Domains - defen.com is for sale!

Defen4.com
403 Forbidden

Defen95.com
Personal Protective Equipment Manufacturer | Protective Mask N95

Defenbang.com
山西教育网太原家教网一对一家教家庭辅导父母教育作业辅导

Defenberg.xyz
defenberg.xyz - Registered at Namecheap.com

Defenbio.com
BIOFUTUR RENOVABLES – ENERGÍA DE AUTOCONSUMO

Recently Searched Keywords

ember inns (1 second ago.), soal try out pppk bahasa inggris 2021 (1 second ago.), boost meaning (1 second ago.), konsentrasi anak berdasarkan (2 seconds ago.), smartlinx (2 seconds ago.), 40 386 52 (3 seconds ago.), breaking vehicles (4 seconds ago.), thatll (5 seconds ago.), stilo aa litio (5 seconds ago.), 1210 (5 seconds ago.), smart watch (5 seconds ago.), bavurusu (6 seconds ago.), oilers 50 (7 seconds ago.), skate - (7 seconds ago.), migration meaning in arabic (7 seconds ago.), background-color 1e73beimportant (8 seconds ago.), site recaptcha (9 seconds ago.), giffey (9 seconds ago.), esta pregunta (9 seconds ago.), kalkulator odsetek maksymalnych (10 seconds ago.), pubg pc pubg (10 seconds ago.), showalertboxalert-warning (10 seconds ago.), 0px blog-carousel-shortcodeblog-carousel-shortcode-id-bdc450ca4f1b644a5202b03a4c932965 owl-nav (11 seconds ago.), dijital gülüş dizaynı (11 seconds ago.), if you like latvia, latvia likes you (12 seconds ago.), canottebasket recensione (12 seconds ago.), show visitors more (13 seconds ago.), términos y cond. (13 seconds ago.), 0800 4 (14 seconds ago.), hearing protection jabra hearing protection standards (15 seconds ago.),