U.S. Department of Defense

Safety: High trust score
Year Founded: 2022
Global Traffic Rank: 1,990
Estimated Worth: $8,119,440

The Department of Defense is America's largest government agency. Our mission is to provide the military forces needed to deter war and ensure our nation's security.



Domain summary

Last updated
2022-01-06
Domain label
defense
Domain extension
gov
Global Traffic Rank
1,990
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$8,119,440
Estimated daily income
$7,518
Estimated monthly income
$228,673

Frequently Asked Questions (FAQ)

Q: When was Defense.gov registered?
A: Defense.gov was registered 4 months, 2 weeks, 2 days, 17 hours, 50 minutes, 13 seconds ago on Thursday, January 6, 2022.
Q: When was the WHOIS for Defense.gov last updated?
A: The WHOIS entry was last updated 4 months, 2 weeks, 2 days, 17 hours, 50 minutes, 13 seconds ago on Thursday, January 6, 2022.
Q: What are Defense.gov's nameservers?
A: DNS for Defense.gov is provided by the following nameservers:
  • use2.akam.net
  • ns1-95.akam.net
  • ns1-116.akam.net
  • use9.akam.net
  • eur6.akam.net
  • asia3.akam.net
  • asia2.akam.net
  • usc5.akam.net
Q: Who is the registrar for the Defense.gov domain?
A: The domain has been registered at .
Q: What is the traffic rank for Defense.gov?
A: Defense.gov ranks 1,990 globally on Alexa. Defense.gov has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Defense.gov each day?
A: Defense.gov receives approximately 939,698 visitors and 7,517,584 page impressions per day.
Q: What IP address does Defense.gov resolve to?
A: Defense.gov resolves to the IPv4 address .
Q: In what country are Defense.gov servers located in?
A: Defense.gov has servers located in the .
Q: What webserver software does Defense.gov use?
A: Defense.gov is powered by webserver.
Q: Who hosts Defense.gov?
A: Defense.gov is hosted by Unknown in .
Q: How much is Defense.gov worth?
A: Defense.gov has an estimated worth of $8,119,440. An average daily income of approximately $7,518, which is roughly $228,673 per month.

Defense.gov Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Defense.gov Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Defense.gov

H1 Headings

1 :
  1. U.S. Department of Defense

H2 Headings

9 :
  1. Austin Looking Forward to Discussions With Japanese Counterpart
  2. News
  3. Press Products
  4. From The Services
  5. Interactive Experiences
  6. Experience DOD
  7. DOD in Photos: 2021
  8. Tomb of the Unknown Soldier
  9. Four-Legged Fighters

H3 Headings

22 :
  1. Coronavirus: DOD Response
  2. Tackling the Climate Crisis
  3. Secretary of Defense Lloyd J. Austin III
  4. U.S. Troops in Iraq Remain at Risk, Retain Right of Self-Defense, Press Secretary Says
  5. Face of Defense: Teaching Young Athletes to 'Unite and Believe'
  6. Military Health
  7. Sunny Anderson, Former Air Force Broadcaster, Now a Food Network Star
  8. Stars Behind the Stripes
  9. Readout of Secretary of Defense Lloyd J. Austin III's Call With Russian Minister of Defense Sergey Shoygu
  10. Readout of Secretary of Defense Lloyd J. Austin III's Call With U.K. Secretary of State for Defense Ben Wallace
  11. Pentagon Press Secretary John Kirby Holds an Off-Camera Press Briefing
  12. Soldiers Prepare for Middle East Deployment
  13. F-35C Squadron Makes Marine Corps History
  14. USS Constitution Gets First Female Commander
  15. Culture App Features New Courses on China, Russia
  16. Space Force Launches New Public Website
  17. Maryland Guard Activated for COVID-19 Emergency
  18. Multimedia
  19. Defense.gov
  20. Helpful Links
  21. Resources
  22. Popular

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

21 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

107:

Links - Internal (nofollow)

0:

Links - Outbound

23:

Links - Outbound (nofollow)

0:

Keyword Cloud for Defense.gov

experiencesliderwrappeopleisdvidsslideitemfeatureisvideo slideindex slideindexyour militarylloyd jifhandles multipletitleslideindex slideidyourunknown virin nullfunction emakesjson stylebehindshowamericanuseoverlaybyline marine corpspentagon pressjson style twoisyoutube false slideindextokens that helpknowcasewhilepetty officer 2ndarpartsstoriesget somewidthcoronavirus dod responsenested structure convertneeded data such0marshalling the datanavyfalse isyoutube falsejdata marshallingmaxwidthlittlesgtiii39sstartprogressbarsecuritychairmanvideodurationpress secretary johnjapannumslidesfalse datapreventdistortionclass titlewidehistoryisvideo isvideo2022 primarywidthfighthandles multiple settingsmarshallingfoodreadout of secretary8submitsearchthispentagon press secretaryelseallcenginedata one advantagedefensepentagonmissionsfunctionnextarrowcurrentlyend of itemvirin nullrightdata oneaustin iii39s callairmansunnyvideodate unknowntarget self imageurlaustinfalse isyoutubelivepressuseoverlay useoverlayunknownhandleshealthisdvids false isyoutubeuseoverlay falsebyline airreturnprimaryheightslideindex slidespushslideitemmultiplemore eventsend2021 primarywidthcoronavirus dodproductscrisisslideindex slideindex slideidevents currentlyconverttemplate footeraltussome tokensbasetrue isvideo falseaustin iii39suseoverlay useoverlay isvideogetdateformatitembeginnbsp itemtitleussadvantage a littlehis1210officerlanceface3 2022 primarywidthdata suchconditionalisdvids falseknow yourhavesnowstripesforce spaceneeded dataslideindexstaffnationalchiefsarvalsecretarymarshalling it wouldslidesseaspotlightsmediacontent videodurationconditional slideitem linkexperiencesnotstateisyoutube falsesnowballcompetitionmarine corps lancenavy petty officerfalse isdvidshighfalse data marshallingfootercplprimaryheight 511 serverindexfalse slideindex slidespushslideitemcallself imageurlspotlighteventsfalse isdvids falsenestedclimatenull booleansprimaryheight 511austin iiivideos765 primaryheight2511 serverindexresponse6convert to jsonnewsitscorps lancefalse videoduration falseuseoverlay false isvideobylineforce space forcenavy pettypettyfalse slideindex2021 primarywidth 765slideindex slidespushslideitem endunknown virinpetty officermultiple settingsprimarywidth 765 primaryheightfalse videodurationcockpitservicesjannullisimage trueisyoutubeuseoverlay isvideo isvideoget some tokensdepartment of defenseclearer and handlesj austin iii39stroopshelp injectvideoduration videodate unknownfooter templateisimageletslidecounttacklingisimage true isvideostructure convert11heightinject the neededjan 3 2022duringprevarrow nextarrowstyle twofalsesnowball fightisvideo isvideo slideindexnice to getmissionofficer 2nd classforceandersonlinktokenspress productsitem template footersecretary johnsuchstarshastombnull booleans isimagebooleans isimageitemcorpsserverhiresimageurlbuilding in ctemplateconstreadyvideoduration falsecoronaviruscomponentstheirtackling the climateconditional slideitemisvideo false isdvidsaboard the usscoverreadaspectratioitemtitlenumcolstrue isvideobreakhelpaffiliateprimarywidth 765advantagedefaultcorps lance cplunknown soldierclassdescription navy0 arpartsinteractive experiences7defense lloydjsonslidespushslideitemduring a competitiontruenicephotos videossecretary of defensetemplate useoverlay falsemediacontentlance cplwindowmatchmediaminwidthj austinmilitary healthbyline marinenowair forcegstargetwouldmorereadoutlittle clearerkirbyneededsearchstylestructurespace forcetemplate useoverlaynumrowsclearertwodescriptiongetdateformatitembeginnbspprimaryheight 510videoduration false datadefense department2nd classministerinteractivemultiple settings linesslidespushslideitem endvartemplate footer templatepress secretarylloyd j austinc as nestedvideoduration videodateimageurlprimaryheight 510 serverindexfooter template useoverlaysecretary of state3 2022japaneselloydisvideo falseprevarrowclimate crisisvideodateisvideo slideindexspaceplaceslideidskinvarsaidiii39s callathletes2ndone advantagebooleansarmytarget selfiraqpreventdistortionclass4supportdodnested structurefalse isvideo falseforcesmediacontent videoduration videodateread moreitem templatedatamarinetheysunny andersonselfaboardisvideowould be niceguardbooleans isimage truefalse isvideoj austin iiipreparejointofficer 2ndretainairdotsserverindexvirinnewtargetgetsoldierslideindex slideindexlines in conditional9lineselse ifdepartment1photostwo for marshallingmilitarychiefs of staffeprimarywidthciviliandefense lloyd jnational guardface of defensevirin null booleansisvideo false videodurationfademarine corpsslideitem linkjohn3alt twodod responsejoint chiefsmultimedia5settingsfunction returnjan 3service510 serverindex2022 primarywidth 765buildingvideodate unknown virinsuch as buildingbyline air forceinputnamefootersearchsomeuseoverlay isvideo765 primaryheight 510oneknow your militarydecinjectiiisettings lines

Longtail Keyword Density for Defense.gov

KeywordsOccurences
secretary of defense14
marshalling the data13
lines in conditional12
slideindex slidespushslideitem end12
isvideo isvideo slideindex12
useoverlay isvideo isvideo12
useoverlay useoverlay isvideo12
target self imageurl12
conditional slideitem link12
handles multiple settings12
multiple settings lines12
clearer and handles12
advantage a little12
data one advantage12
two for marshalling12
json style two12
isvideo slideindex slideindex12
slideindex slideindex slideid12
nested structure convert12
false slideindex slidespushslideitem12
isyoutube false slideindex12
false isyoutube false12
mediacontent videoduration videodate12
videoduration videodate unknown12
videodate unknown virin12
unknown virin null12
virin null booleans12
null booleans isimage12
booleans isimage true12
isimage true isvideo12
true isvideo false12
isvideo false isdvids12
convert to json12
building in c12
c as nested12
videoduration false data12
template footer template12
item template footer12
end of item12
isdvids false isyoutube12
useoverlay false isvideo12
false isvideo false12
isvideo false videoduration12
false videoduration false12
template useoverlay false12
false data marshalling12
inject the needed12
marshalling it would12
such as building12
needed data such12
false isdvids false12
tokens that help12
get some tokens12
nice to get12
would be nice12
footer template useoverlay11
primarywidth 765 primaryheight8
lloyd j austin8
defense lloyd j8
primaryheight 510 serverindex8
765 primaryheight 5106
jan 3 20225
3 2022 primarywidth5
petty officer 2nd4
officer 2nd class4
byline marine corps4
navy petty officer4
department of defense4
primaryheight 511 serverindex4
2022 primarywidth 7654
tackling the climate4
face of defense4
chiefs of staff4
j austin iii4
readout of secretary4
j austin iii39s4
austin iii39s call4
coronavirus dod response4
2021 primarywidth 7654
know your military3
press secretary john3
pentagon press secretary3
aboard the uss3
secretary of state3
force space force3
marine corps lance3
corps lance cpl3
during a competition3
byline air force3
isvideo false24
air force13
item template13
useoverlay isvideo13
one advantage12
template footer12
slideitem link12
conditional slideitem12
settings lines12
multiple settings12
handles multiple12
little clearer12
json style12
data one12
style two12
self imageurl12
structure convert12
nested structure12
data such12
needed data12
help inject12
target self12
preventdistortionclass title12
slideindex slidespushslideitem12
virin null12
isyoutube false12
false isyoutube12
isdvids false12
false isdvids12
true isvideo12
isimage true12
booleans isimage12
null booleans12
unknown virin12
useoverlay useoverlay12
videodate unknown12
videoduration videodate12
mediacontent videoduration12
slidespushslideitem end12
slideindex slideid12
slideindex slideindex12
isvideo slideindex12
isvideo isvideo12
some tokens12
get some12
data marshalling12
template useoverlay12
marine corps12
false data12
footer template12
false slideindex12
useoverlay false12
false isvideo12
videoduration false12
false videoduration12
j austin8
lloyd j8
765 primaryheight8
primarywidth 7658
2022 primarywidth8
primaryheight 5108
510 serverindex8
defense lloyd8
function return6
coronavirus dod5
space force5
3 20225
else if5
jan 35
press secretary5
byline marine4
austin iii39s4
0 arparts4
dod response4
climate crisis4
joint chiefs4
iii39s call4
2021 primarywidth4
navy petty4
petty officer4
officer 2nd4
austin iii4
511 serverindex4
primaryheight 5114
2nd class4
corps lance3
alt two3
description navy3
snowball fight3
lance cpl3
press products3
byline air3
more events3
interactive experiences3
force space3
national guard3
defense department3
read more3
prevarrow nextarrow3
events currently3
getdateformatitembeginnbsp itemtitle3
photos videos3
pentagon press3
secretary john3
know your3
your military3
military health3
sunny anderson3
unknown soldier3
function e3
false81
isvideo49
data38
useoverlay37
slideindex37
defense32
template26
marshalling26
videoduration25
function25
const25
link24
true24
secretary22
force22
if19
air16
var16
unknown15
return15
two15
title14
military14
corps13
needed13
slideitem13
style13
item13
end13
dod13
numcols13
marine13
little12
clearer12
handles12
multiple12
advantage12
settings12
imageurl12
lines12
conditional12
self12
serverhiresimageurl12
preventdistortionclass12
slideid12
byline12
one12
target12
json12
convert12
structure12
nested12
c12
description12
such12
inject12
help12
tokens12
some12
get12
nice12
would12
012
building12
alt12
virin12
primaryheight12
null12
isimage12
footer12
videodate12
isdvids12
mediacontent12
serverindex12
booleans12
primarywidth12
isyoutube12
slidespushslideitem12
press11
department11
111
austin10
us10
j10
more9
events9
let9
29
38
navy8
48
jan8
lloyd8
58
news8
climate7
face7
guard7
arparts7
else7
67
all6
coronavirus6
during6
76
aspectratio6
stories6
86
army6
space6
national6
itemtitle6
cpl5
multimedia5
width5
now5
95
response5
e5
aboard5
uss5
spotlight5
live5
iii5
soldier5
staff5
photos5
submitsearchthis4
height4
class4
snow4
2nd4
cockpit4
airman4
dec4
sgt4
104
competition4
sea4
petty4
officer4
while4
startprogressbar4
tackling4
crisis4
call4
iii39s4
readout4
spotlights4
your4
currently4
chairman4
has4
joint4
chiefs4
health4
search4
his4
japanese4
new4
john4
minister4
wide4
break4
case4
troops4
high4
fade4
arval4
right4
cover4
feature4
services4
state4
missions3
dots3
security3
prevarrow3
base3
read3
numslides3
japan3
civilian3
components3
support3
experiences3
interactive3
videos3
lance3
products3
engine3
snowball3
fight3
skinvarsaid3
inputnamefooter-search3
place3
nextarrow3
mission3
max-width3
they3
history3
its3
people3
prepare3
experience-slider-wrap3
tomb3
not3
american3
stripes3
113
123
default3
slides3
numrows3
slidecount3
gstarget3
makes3
behind3
show3
know3
getdateformatitembeginnbsp3
iraq3
retain3
windowmatchmediamin-width3
forces3
pentagon3
kirby3
athletes3
stars3
have3
ready3
service3
their3
sunny3
anderson3
food3
affiliate3

Who hosts Defense.gov?

Defense.gov Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Not Applicable

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.9161%
GOOGLE
14.0532%
AS-26496-GO-DADDY-COM-LLC
3.4879%
NAMECHEAP-NET
3.1470%
AMAZON-AES
2.2136%
GoDaddy.com, LLC
2.0287%
UNIFIEDLAYER-AS-1
1.9645%
Fara Negar Pardaz Khuzestan
1.6143%
CONFLUENCE-NETWORK-INC
1.4660%
1&1 Internet AG
1.3358%

HTTP Header Analysis for Defense.gov

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache,private
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Expires: -1
X-AspNetMvc-Version:
X-UA-Compatible: IE=edge
pw_value: 3ce3af822980b849665e8c5400e1b45b
Access-Control-Allow-Origin: *
X-XSS-Protection: 1; mode=block
X-Frame-Options: SAMEORIGIN
X-Powered-By:
Server:
X-ASPNET-VERSION:
X-Content-Type-Options: nosniff
Content-Encoding: gzip
Content-Length: 33577
Date: Thu, 06 Jan 2022 18:53:00 GMT
Connection: keep-alive
Vary: Accept-Encoding
Strict-Transport-Security: max-age=31536000

Defense.gov Domain Nameserver Information

HostIP AddressCountry
use2.akam.net 96.7.49.64
ns1-95.akam.net 193.108.91.95
ns1-116.akam.net 193.108.91.116
use9.akam.net 72.246.46.65
eur6.akam.net 2.22.230.64
asia3.akam.net 23.211.61.64
asia2.akam.net 95.101.36.64
usc5.akam.net 96.7.50.65


Need to find out who hosts Defense.gov?


Domain Registration (WhoIs) information for Defense.gov

 % DOTGOV WHOIS Server ready
Domain Name: DEFENSE.GOV
Status: ACTIVE
Security Contact Email: Login to show email
Last update of whois database: 2022-01-06T11:00:02Z

Websites with Similar Names

Defen.com
Buy Domains - defen.com is for sale!
Defen4.com
403 Forbidden
Defen95.com
Personal Protective Equipment Manufacturer | Protective Mask N95
Defenbang.com
山西教育网 太原家教网 一对一家教 家庭辅导 父母教育 作业辅导
Defenberg.xyz
defenberg.xyz - Registered at Namecheap.com
Defenbio.com
BIOFUTUR RENOVABLES – ENERGÍA DE AUTOCONSUMO

Recently Updated Websites

Pin-up-website-tr.site (32 minutes 52 seconds ago.)Eg.2holz.com (41 minutes 36 seconds ago.)Bk8sam.com (56 minutes 9 seconds ago.)Careergoogle.com (1 hour 31 minutes ago.)Idescarga.com (1 hour 34 minutes ago.)Myqloud.org (1 hour 42 minutes ago.)Shiningstardiamonds.com (2 hours 39 minutes ago.)Purejewels.com (2 hours 40 minutes ago.)Dynamics.microsoft.com (3 hours 3 minutes ago.)Preview.redd.it (3 hours 18 minutes ago.)Star-card.net (3 hours 31 minutes ago.)Graciassafaris.com (3 hours 56 minutes ago.)Taksi-tiraspol.ru (3 hours 59 minutes ago.)Download.masterplansindia.com (4 hours 27 minutes ago.)Masterplansindia.com (4 hours 27 minutes ago.)App.y2mate.com (4 hours 48 minutes ago.)Highlevelmoverscalgary.ca (4 hours 50 minutes ago.)About-azusa.site (5 hours 7 minutes ago.)Wistore.ir (6 hours 22 minutes ago.)Nenvar.com (6 hours 28 minutes ago.)Freecronaca.it (7 hours 21 minutes ago.)Reviewsfog.com (7 hours 51 minutes ago.)Cryptoreclaimfraud.com (8 hours 5 minutes ago.)Pinup-uz.xyz (8 hours 18 minutes ago.)Pinup-azer.xyz (8 hours 25 minutes ago.)Pinup-bonus.in (8 hours 27 minutes ago.)Pin-up-ukraine.org (8 hours 28 minutes ago.)Pinup-slot-kz.com (8 hours 33 minutes ago.)Pin-up-mobile.com (8 hours 36 minutes ago.)Loekerja.my.id (9 hours 4 minutes ago.)

Recently Searched Keywords

ember inns (1 second ago.)soal try out pppk bahasa inggris 2021 (1 second ago.)boost meaning (1 second ago.)konsentrasi anak berdasarkan (2 seconds ago.)smartlinx (2 seconds ago.)40 386 52 (3 seconds ago.)breaking vehicles (4 seconds ago.)thatll (5 seconds ago.)stilo aa litio (5 seconds ago.)1210 (5 seconds ago.)smart watch  (5 seconds ago.)bavurusu (6 seconds ago.)oilers 50 (7 seconds ago.)skate - (7 seconds ago.)migration meaning in arabic (7 seconds ago.)background-color 1e73beimportant (8 seconds ago.)site recaptcha (9 seconds ago.)giffey (9 seconds ago.)esta pregunta (9 seconds ago.)kalkulator odsetek maksymalnych (10 seconds ago.)pubg pc pubg (10 seconds ago.)showalertboxalert-warning (10 seconds ago.)0px blog-carousel-shortcodeblog-carousel-shortcode-id-bdc450ca4f1b644a5202b03a4c932965 owl-nav (11 seconds ago.)dijital gülüş dizaynı (11 seconds ago.)if you like latvia, latvia likes you (12 seconds ago.)canottebasket recensione (12 seconds ago.)show visitors more (13 seconds ago.)términos y cond. (13 seconds ago.)0800 4 (14 seconds ago.)hearing protection jabra hearing protection standards (15 seconds ago.)