Dentalpenques.com.br Favicon Dentalpenques.com.br

Dentalpenques.com.br Website Thumbnail
Checking...
Dental Penques - Vendas e Assistência Técnica
Low trust score
Add a review Change category Claim this site
Vendas de equipamentos multimarcas, assistência técnica autorizada, peças de reposição originais. Dabi Atlante, Cristófoli, Schuster, Stermax, Sercon, Beltec...


Domain summary

Domain label
dentalpenques
Domain extension
com.br
Domain registered:
2011-01-19
Domain updated:
2020-01-21
Domain expires:
2022-01-19
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is dentalpenques.com.br ranked relative to other sites:

Percentage of visits to dentalpenques.com.br from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Dentalpenques.com.br registered?
A: Dentalpenques.com.br was registered 9 years, 8 months, 1 week, 3 days, 5 hours, 17 minutes, 17 seconds ago on Wednesday, January 19, 2011.
Q: When was the WHOIS for Dentalpenques.com.br last updated?
A: The WHOIS entry was last updated 8 months, 1 week, 1 day, 5 hours, 17 minutes, 17 seconds ago on Tuesday, January 21, 2020.
Q: What are Dentalpenques.com.br's nameservers?
A: DNS for Dentalpenques.com.br is provided by the following nameservers:
  • ns2.wixdns.net
  • ns3.wixdns.net
Q: Who is the registrar for the Dentalpenques.com.br domain?
A: The domain has been registered at BR-NIC.
Q: What is the traffic rank for Dentalpenques.com.br?
A: Dentalpenques.com.br has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Dentalpenques.com.br each day?
A: Dentalpenques.com.br receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Dentalpenques.com.br resolve to?
A: Dentalpenques.com.br resolves to the IPv4 address 23.236.62.147.
Q: In what country are Dentalpenques.com.br servers located in?
A: Dentalpenques.com.br has servers located in the United States.
Q: What webserver software does Dentalpenques.com.br use?
A: Dentalpenques.com.br is powered by webserver.
Q: Who hosts Dentalpenques.com.br?
A: Dentalpenques.com.br is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Dentalpenques.com.br worth?
A: Dentalpenques.com.br has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Dentalpenques.com.br?

Dentalpenques.com.br Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Not Applicable

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Dentalpenques.com.br

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Wed, 09 Sep 2020 14:21:06 GMT
Content-Length: 0
Connection: keep-alive
location: https://www.dentalpenques.com.br/
content-language: en
X-Wix-Request-Id: 1599661266.66833634824690856338
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=42
X-Seen-By: 6ivkWfREES4Y8b2pOpzk7Owfbs 7qUVAqsIx00yI78k=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkViozyX1iilefXjG31S4IO7n,2d58ifebGbosy5xc FRalu8ETvwcN8dtapVDFPQ5Bci/0j2/LHJ a1mpfT/yblfYyOonyIQ1venVt57555mm/w==,2UNV7KOq4oGjA5 PKsX47COQw3BjVFoMBu6hWXG/pBM=,m0j2EEknGIVUW/liY8BLLpKBwxGlovVE0fM/42WHC0w=,1wy2ILu/S4rlWT/R4rqCrebcjIMByiV8GkDpbP5d8Go=,WcrWvzU6 v56AFbpVWES8sURWYrk cakWoNdeHftjuUaWyug/ZdHQ36uOAkr89T0,x1Sj9Xv8W8xC18ngt0x3MwnSeDI1A IA70mRwV3s461CoYHJ2nbwfupxnhp0fLirBFNjNRTmQgt5BwMmIVG00A==
Cache-Control: no-cache
Expires: -1

Dentalpenques.com.br Domain Nameserver Information

HostIP AddressCountry
ns2.wixdns.net 216.239.36.100
ns3.wixdns.net 216.239.38.100


Need to find out who hosts Dentalpenques.com.br?


WhoIs information for Dentalpenques.com.br

 % Copyright (c) Nic.br
% The use of the data below is only permitted as described in
% full by the terms of use at https://registro.br/termo/en.html ,
% being prohibited its distribution, commercialization or
% reproduction, in particular, to use it for advertising or
% any similar purpose.
% 2020-05-07T00:17:02-03:00

domain: dentalpenques.com.br
owner: VALDIR PENQUES ME
owner-c: VAPEN5
admin-c: VAPEN5
tech-c: VAPEN5
billing-c: VAPEN5
nserver: ns2.wixdns.net
nsstat: 20200506 AA
nslastaa: 20200506
nserver: ns3.wixdns.net
nsstat: 20200506 AA
nslastaa: 20200506
saci: yes
created: 20110119 #7801499
changed: 20200121
expires: 20220119
status: published

nic-hdl-br: VAPEN5
person: Valdir Penques
created: 20110212
changed: 20160126

% Security and mail abuse issues should also be addressed to
% cert.br, http://www.cert.br/ , respectivelly to Login to show email
and Login to show email
whois.registro.br accepts only direct match queries. Types
% of queries are: domain (.br), registrant (tax ID), ticket,
% provider, contact handle (ID), CIDR block, IP and ASN.

Dentalpenques.com.br Free SEO Report

Website Inpage Analysis for Dentalpenques.com.br

H1 Headings

0 :

H2 Headings

18 :
  1. Pra montar
  2. seu primeiro 
  3. consultório,
  4. ou para renovar
  5. sua clínica,
  6. conte conosco!
  7. Autoclaves
  8. Manutenção de Peças de Mão
  9. Manutenção de Peças de Mão
  10. Manutenção em compressores
  11. Peças de mão
  12. Profi/ultrassom
  13. Compressores
  14. Raio X
  15.  CENTRO TÉCNICO 
  16. Seja bem vindo!
  17. (12) 3633-6825
  18. (12) 99781-2081

H3 Headings

1 :
  1. Vendas e Assistência Técnica

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

3 :

Total Images

14 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-41511644-1

Links - Internal

12:
  1. #mask-comp-kanw8s2ximg-svg * {fill: #fff; stroke: #fff; stroke-width: 0;}
    https://www.dentalpenques.com.br
  2. 0
    https://www.dentalpenques.com.br/cart
  3. Peças Originais de Fábrica
    https://www.dentalpenques.com.br/lojadepecas
  4. #mask-WPhtb-n0iimg-svg * {fill: #fff; stroke: #fff; stroke-width: 0;}
    https://www.dentalpenques.com.br/pecascristofoli
  5. No text
    https://www.dentalpenques.com.br/pecas-dabi
  6. No text
    https://www.dentalpenques.com.br/pecas-sercon
  7. No text
    https://www.dentalpenques.com.br/pecas-stermax
  8. INÍCIO
    https://www.dentalpenques.com.br
  9. SOBRE
    https://www.dentalpenques.com.br/sobre
  10. SERVIÇOS
    https://www.dentalpenques.com.br/servicos
  11. CONTATO
    https://www.dentalpenques.com.br/contato
  12. LOJA
    https://www.dentalpenques.com.br/loja

Links - Internal (nofollow)

0:

Links - Outbound

7:
  1. No text
    https://api.whatsapp.com/send?1=pt_BR&phone=5512997812081
  2. Solicite orçamento
    https://api.whatsapp.com/send?1=pt_BR&phone=5512997812081
  3. Agende via whatsapp
    https://api.whatsapp.com/send?1=pt_BR&phone=5512997812081
  4. No text
    https://wa.me/message/ZGY4FCMVN47GO1
  5. No text
    https://www.youtube.com/channel/UC41hEU19uJNNYe16FYWLFEw?view_as=subscriber
  6. No text
    https://www.instagram.com/dentalpenques/
  7. No text
    http://www.facebook.com/dentalpenquesTTE

Links - Outbound (nofollow)

0:

Keyword Cloud for Dentalpenques.com.br

dental dental penquessvg datacolor1penques vendasreposioplaca reservatriobackgroundcolorrgba61 155borderstylesolidbordercolorrgba249 249 249multimarcascoloriframewebkitfullscreen minheightauto importantautoclavestrc1inlinecontentautoclavesreposio originaisschuster stermaxfontnormalarial sansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncenter1backgroundcolorrgba255 255 255peas originaisstylekao5js52navcontainerarrowstylekao5js52navcontainercenterdirection04s ease 0sborderstylesolidbordercolorrgba249 249schuster stermax serconstermax sercon beltecmetakeywordsseodabinormal 16px14em questrialsansserifjpeascolor ffffff255 1assistncia155 233multimarcas assistnciamultimarcas assistncia tcnicahelvetica arial sansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncenterborderradius0oldirrtloverflowhidden1bordersolidvectoreffectnonscalingstrokecolor0099fftextdecorationunderlinecursorpointerrgba471backgroundcolorrgba255stylekao5js52navcontainercenterdirectioniframewebkitfullscreenvendas estylekao9rn5alinkiframe positionabsolutewidth100height100overflowhidden16px14em questrialsansserifpeas dentalhelveticaneuew0155roma helveticaneuew0255roma helveticaneuew1055romaimportantleftauto249 249datacolor1dentalstylekao5js52repeaterbuttongapper border093 1normal normal 15px14em1inscfontsize80px importantsvg datacolor1 fillolrgba255 255 255ariallb1itemscontainer255 2557color373737fontfamilyhelvetica neue helveticaneuew0155romatxtnew ulhelvetica arialesercon beltecmetakeywordsseodabipenques autoclavespagetitleseodental penqueshelveticaneuew1055roma helvetica arialmargin0lineheightnormalletterspacingnormalborder0datacolor1 fill rgba255easehelveticaneuew0255roma helveticaneuew1055roma249 1backgroundcolorrgba255ol ulultxtnew olstrc1dataresponsivecristfoli schuster stermaxsvgfill rgba0 46borderradius0 0 0stylekao5js52repeaterbuttongapperpeas de reposio0509fontsize0margintop5pxrgba0 46 93fontfamilyhelveticapeas dental dental0pxultxtnewpositionabsolutetop0left0color373737width100height100margin0stylekao5js52navcontainerarrow stylekao5js52navcontainersvgcontainerassistncia tcnicastermax serconstylekao5js52navcontainerarrowrgba255 255atlantestroke fffautoclavespagetitleseodental penquesnfff strokewidthhelveticaneuew0155romafontautoclavespagetitleseodental penques vendasborderwidth2pxcalc100 980pxwebkittaphighlightcolorrgba0 0 0autorizada peasfill rgba255 2551inscfontsize75px importantminheightauto important46 46 1arial sansserifdisplaynone16px14emautorizadaplacaborderradius0 0rgba255topautobottom0fontfamilyhelvetica neue helveticaneuew0155romaselectdataerrortrue1 stylekao5js52navcontainer4strokesansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncentervitalestermaxoverflowvisibleassistncia tcnica autorizadamarginleft calc100 980px8fill5pxdental penquesborderwidth2px borderstylesolidbordercolorrgba249ease 0sfill fff strokepositionabsolutetop0right0bottom0left0iframeffffffdatacolor1 fillvarschusterimportantzindex50positionfixed importantleftautoborderwidth2px borderstylesolidbordercolorrgba249 249normal 15px14em249 1backgroundcolorrgba255 255onlinewidth100height100backgroundrgba255 255ul255 1 stylekao5js52navcontainerneue helveticaneuew0155romatcnicafont normalcalc100beltecmetakeywordsseodabi46 93 1fill rgba2550 0strokewidth 0positionabsolutetop0right0bottom0left0width100height100marginautocalc100 980px 05dabi atlantestylekao9rn5alabel0 200backgroundcolor ffffffn nreposio originais dabi5backgroundcolorminheightautodinnextw01lightdinnextw02lightdinnextw10lightsansserif color605e5estylekao4vtmnlabelwrapperborderstylesolidbordercolorrgba2490sserconnormal normal 16px14emquestrialsansseriffontnormal normal9color605e5ewidth100height100backgroundrgba255 255 255rgba47 463neue helveticaneuew0155roma helveticaneuew0255romaimportantstylekao9rn5alabelwrappersansserifdisplaynonedabistylekao5js52navcontainerarrowstylekao5js52navcontainerleftdirection255 255 1helveticaneuew1055romasercon beltecmetakeywordsseodabi atlante46 93strokewidthfontfamilyhelvetica neuecristfoli peas dentaldental dentalfill fff6equipamentos multimarcasoriginaisfff strokewidth 0stylekao4vtmnlabeldisplaynonecolor373737fontfamilyhelvetica neueimportantleftauto importantzindex50cristfoli schustern n nsvg positionabsolutetop0right0bottom0left0width100height100marginauto46 46vendas e assistncia980px 05b0b0b0atlante cristfoli schusternormal 16px14emonline peas originaisultrassomdental penques autoclavespagetitleseodentalhelveticaneuew0155roma helveticaneuew0255romastylekao5js52repeaterbuttonlabeloriginais dabi249 249 1backgroundcolorrgba255reservatriotxtnewopacity1tcnica autorizada peasmarginleftifselectdatapreviewerror stylekao5js52navcontainerarrow1inscfontsize60pxtcnica autorizadanormal normalnormalstylekao5js52navcontainerrightdirectionpositionfixed importantleftauto importantzindex50rgba0 4610255 255 09fontsize0margintop5px255 09fontsize0margintop5pxbackgroundcolorrgba61 155 233e assistncia1inscfontsize75px0stylekao4vtmnlinkstylekao5js52repeaterbuttondatastatedropsvg overflowvisiblergba47 46 46displayinlineblockwebkittaphighlightcolorrgba0 0penques autoclavespagetitleseodentaliframewebkitfullscreen minheightautoselectdatapreviewfocusneuestylekao5js52navcontainersvgcontainerstroke fff strokewidthmarginleft calc100rgba0originais dabi atlantehelveticaneuew0255romadatacolor1 fill rgba015px14emhelveticaneuew0255roma helveticaneuew1055roma helvetica1inscfontsize60px importantwidth100height100backgroundrgba255ffffont normal normal204 204autoclavespagetitleseodentaldabi atlante cristfolicristfolihelvetica arial sansserifdisplaynone04sselectdatapreviewerrorvendas1inscfontsize80pxequipamentoscristfoli peaspositionabsolutewidth100height100overflowhiddenstylekanv8if7bgdinnextw01lightdinnextw02lightdinnextw10lightsansserif46 1fill rgba0width100height100positionfixed0 0 0selectfocus1backgroundcolorrgba255 255fff strokeselecthoverequipamentos multimarcas assistncia980pxstylekao5js52navcontainerarrowstylekao5js52navcontainerrightdirectionatlante cristfolipenquespenques vendas e3tstqsolidbeltecmetakeywordsseodabi atlante cristfolihelveticafff stroke fffstylekao5js52navcontainerbackgroundcolorrgba612margin0lineheightnormalletterspacingnormal txtnewcolor373737fontfamilyhelvetica04s easeatlante cristfoli peasnormal normal normalparawebkittaphighlightcolorrgba0online peasselectdatapreviewhoverstylekao5js52navcontainerleftdirectionhelveticaneuew1055roma helvetica1beltecmetakeywordsseodabi atlante

Longtail Keyword Density for Dentalpenques.com.br

KeywordsOccurences
calc100 980px 0561
margin-left calc100 980px61
0 0 013
04s ease 0s13
normal normal normal12
font normal normal11
rgba0 46 938
svg data-color1 fill8
helveticaneuew02-55roma helveticaneuew10-55roma helvetica7
border-radius0 0 07
helveticaneuew10-55roma helvetica arial7
helveticaneuew01-55roma helveticaneuew02-55roma helveticaneuew10-55roma7
neue helveticaneuew01-55roma helveticaneuew02-55roma7
46 93 17
255 255 17
normal normal 15px14em6
originais dabi atlante5
multimarcas assistncia tcnica5
assistncia tcnica autorizada5
tcnica autorizada peas5
peas de reposio5
reposio originais dabi5
equipamentos multimarcas assistncia5
schuster stermax sercon5
vendas e assistncia5
penques vendas e5
dabi atlante cristfoli5
atlante cristfoli schuster5
cristfoli schuster stermax5
stroke fff stroke-width4
fff stroke-width 04
data-color1 fill rgba04
n n n4
fill rgba0 464
border-width2px border-stylesolidborder-colorrgba249 2494
dental dental penques4
online peas originais4
fff stroke fff4
fill fff stroke4
255 1 style-kao5js52navcontainer4
border-stylesolidborder-colorrgba249 249 2494
normal normal 16px14em4
249 249 1background-colorrgba2554
249 1background-colorrgba255 2554
1background-colorrgba255 255 2554
rgba47 46 464
rgba255 255 2553
autoclavespagetitleseodental penques vendas3
penques autoclavespagetitleseodental penques3
dental penques autoclavespagetitleseodental3
peas dental dental3
cristfoli peas dental3
atlante cristfoli peas3
beltecmetakeywordsseodabi atlante cristfoli3
sercon beltecmetakeywordsseodabi atlante3
background-colorrgba61 155 2333
stermax sercon beltecmetakeywordsseodabi3
fill rgba255 2553
positionfixed importantleftauto importantz-index503
iframe-webkit-full-screen min-heightauto important3
width100height100backgroundrgba255 255 2553
255 255 09font-size0margin-top5px3
color373737font-familyhelvetica neue helveticaneuew01-55roma3
helvetica arial sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter3
font-familyhelvetica neue helveticaneuew01-55roma3
helvetica arial sans-serifdisplaynone3
-webkit-tap-highlight-colorrgba0 0 03
normal 16px14em questrialsans-serif3
data-color1 fill rgba2553
46 46 13
margin-left calc10061
calc100 980px61
980px 0561
0 032
normal normal30
ease 0s13
04s ease13
255 25512
font normal11
n n10
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif color605e5e9
155 2339
46 939
rgba0 468
data-color1 fill8
atlante cristfoli8
svg data-color18
helvetica arial7
dental penques7
helveticaneuew02-55roma helveticaneuew10-55roma7
helveticaneuew01-55roma helveticaneuew02-55roma7
neue helveticaneuew01-55roma7
93 17
border-radius0 07
dabi atlante7
helveticaneuew10-55roma helvetica7
0 2007
255 17
margin0line-heightnormalletter-spacingnormal txtnew7
originais dabi6
1inscfont-size60px important6
204 2046
e assistncia6
normal 15px14em6
1 style-kao5js52navcontainer5
peas originais5
equipamentos multimarcas5
multimarcas assistncia5
assistncia tcnica5
tcnica autorizada5
reposio originais5
autorizada peas5
cristfoli schuster5
schuster stermax5
stermax sercon5
penques vendas5
vendas e5
1inscfont-size80px important4
fff stroke4
stroke fff4
fff stroke-width4
stroke-width 04
color ffffff4
normal 16px14em4
online peas4
background-color ffffff4
fill rgba04
dental dental4
fontnormal normal4
fill fff4
txtnew ul4
rgba47 464
46 464
border-stylesolidborder-colorrgba249 2494
249 2494
1background-colorrgba255 2554
border-width2px border-stylesolidborder-colorrgba2494
249 1background-colorrgba2554
positionfixed importantleftauto3
beltecmetakeywordsseodabi atlante3
style-kao5js52repeaterbuttongapper border03
sercon beltecmetakeywordsseodabi3
penques autoclavespagetitleseodental3
cristfoli peas3
peas dental3
autoclavespagetitleseodental penques3
selectdata-previewerror style-kao5js52navcontainerarrow3
style-kao5js52navcontainerarrow style-kao5js52navcontainersvgcontainer3
placa reservatrio3
background-colorrgba61 1553
16px14em questrialsans-serif3
ultxtnew ol3
ol ul3
1inscfont-size75px important3
rgba255 2553
importantleftauto importantz-index503
svg overflowvisible3
svg positionabsolutetop0right0bottom0left0width100height100marginauto3
-webkit-tap-highlight-colorrgba0 03
arial sans-serifdisplaynone3
font-familyhelvetica neue3
fill rgba2553
46 13
color373737font-familyhelvetica neue3
255 09font-size0margin-top5px3
width100height100backgroundrgba255 2553
min-heightauto important3
iframe-webkit-full-screen min-heightauto3
iframe positionabsolutewidth100height100overflowhidden3
arial sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter3
067
980px61
calc10061
margin-left61
0561
normal50
background-color38
color36
important34
124
224
txtnew18
positionabsolutetop0right0bottom0left018
317
n16
peas16
svg15
originais14
ease13
04s13
0s13
style-kao5js52navcontainer13
fill12
dental12
penques12
412
atlante12
assistncia11
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif11
font11
style-kao5js52navcontainerarrow11
ul10
cristfoli10
59
3tstq9
69
color605e5e9
79
data-color18
displaynone8
0px8
88
rgba08
sercon8
ffffff8
fff8
dabi8
helveticaneuew01-55roma7
equipamentos7
neue7
helveticaneuew02-55roma7
para7
helvetica7
arial7
var7
helveticaneuew10-55roma7
97
ol7
border-radius07
margin0line-heightnormalletter-spacingnormal7
style-kao5js52navcontainerarrowstyle-kao5js52navcontainerright-direction6
positionabsolutetop0left0color373737width100height1006
style-kao5js52navcontainerarrowstyle-kao5js52navcontainercenter-direction6
stermax6
solid6
style-kao5js52navcontainerarrowstyle-kao5js52navcontainerleft-direction6
style-kao5js52repeaterbuttongapper6
15px14em6
e6
1inscfont-size60px6
ultxtnew5
tcnica5
if5
multimarcas5
schuster5
autorizada5
vendas5
reposio5
online4
5px4
style-kao4vtmnlabel4
style-kao9rn5alabelwrapper4
style-kao9rn5alink4
style-kao9rn5alabel4
border-width2px4
16px14em4
placa4
rgba474
overflowhidden4
stroke4
stroke-width4
1inscfont-size80px4
questrialsans-serif4
104
lb1itemscontainer4
style-kao4vtmnlabelwrapper4
b0b0b04
style-kao4vtmnlink4
1bordersolid4
border04
border-stylesolidborder-colorrgba2494
1background-colorrgba2554
fontnormal4
style-kao5js52repeaterbuttonlabel4
selectdata-previewhover3
vitale3
background-colorrgba613
style-kao5js52repeaterbuttondata-statedrop3
style-kao5js52navcontainersvgcontainer3
style-kao5js52navcontainerleft-direction3
selecthover3
overflowvisible3
positionfixed3
beltecmetakeywordsseodabi3
autoclavespagetitleseodental3
style-kao5js52navcontainercenter-direction3
style-kao5js52navcontainerright-direction3
ultrassom3
autoclaves3
selectdata-previewerror3
reservatrio3
autoclave3
j3
selectdata-errortrue3
margin03
importantleftauto3
vector-effectnon-scaling-stroke3
sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter3
positionabsolutetop0right0bottom0left0width100height100marginauto3
-webkit-tap-highlight-colorrgba03
strc1data-responsive3
selectdata-previewfocus3
strc1inlinecontent3
opacity13
sans-serifdisplaynone3
font-familyhelvetica3
color0099fftext-decorationunderlinecursorpointer3
oldirrtl3
displayinline-block3
color373737font-familyhelvetica3
importantz-index503
rgba2553
09font-size0margin-top5px3
width100height100backgroundrgba2553
width100height1003
min-heightauto3
iframe-webkit-full-screen3
1inscfont-size75px3
positionabsolutewidth100height100overflowhidden3
iframe3
style-kanv8if7bg3
topautobottom03
selectfocus3

Dentalpenques.com.br Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Dentalpenques.com.br is a scam?

Websites with Similar Names

Denta-app.com
403 Forbidden
Denta-consult.de
denta-consult.de Marketing für Zahnärzte und Dentallabore Birgit Heinrich ( denta-consult ) Akquise Neukunden
Denta-doc.com
??????? ????????????????? ?????????? ?? Denta Doc
Denta-face.com
Дентафейс – клиника по дентална медицина
Denta-k.ru
denta-k.ru — срок регистрации домена истёк
Denta-l31.ru
Семейная стоматология Дента-Л
Denta-line.ru
Стоматология "Денталайн" г.Мурманск Стоматология "Денталайн" г.Мурманск
Denta-lite.ru
Denta-Lite.ru | Интернет-магазин медицинского оборудования с доставкой по России, медицинские инструменты, медицинская мебель оптом и в розницу.
Denta-m-sp.ru
Стоматологический центр Дента-М

Recently Updated Websites

Embryimpressionsprinting.com 2 seconds ago.Thewheatgrassbox.com 3 seconds ago.Mysilentfury.com 3 seconds ago.Paleoeatsandtreats.com 5 seconds ago.Melvincorp.com 5 seconds ago.Ftgw.com 5 seconds ago.Beersandpolitics.com 6 seconds ago.Croatia-maritime.com 7 seconds ago.Stocktickr.com 7 seconds ago.Aquaperu.net 7 seconds ago.Andrzejbobola.pl 8 seconds ago.Attleborocouncilofchurches.org 8 seconds ago.Talenzo.com 8 seconds ago.Gekiyasu-poster.com 9 seconds ago.Zienix.co.uk 9 seconds ago.Alexllopis.com 9 seconds ago.Tokobukubalita.com 9 seconds ago.Typeamktg.com 9 seconds ago.Officeasim.com 10 seconds ago.Harveyshobbyhut.com 10 seconds ago.Cavinggroup.net 11 seconds ago.Lucalancini.com 11 seconds ago.12thirteen.design 11 seconds ago.Hoamaivungtau.com 11 seconds ago.Ilovelibraries.org 11 seconds ago.Worldsoftwaredownloadsone.com 12 seconds ago.Mikethetutor.com 12 seconds ago.Carlsonprojectsinc.com 13 seconds ago.Yippisocial.com 14 seconds ago.Davidsonmediagroup.com 14 seconds ago.