Serviced Apartments in Deutschland & Österreich | Living Hotels

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 613,663
Estimated Worth: $2,400

Klassische Hotellerie & Serviced Apartments ➤ Short- & Longstay ✔ Immer in Bestlage in den Metropolen Deutschlands & Österreichs → Mehr erfahren!



Domain summary

Last updated
2020-11-07
Domain label
deraghotels
Domain extension
de
Global Traffic Rank
613,663
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$2,400
Estimated daily income
$10
Estimated monthly income
$304

Frequently Asked Questions (FAQ)

Q: When was Deraghotels.de registered?
A: Deraghotels.de was registered 7 months, 1 week, 3 days, 9 hours, 1 minute, 52 seconds ago on Saturday, November 7, 2020.
Q: When was the WHOIS for Deraghotels.de last updated?
A: The WHOIS entry was last updated 9 months, 1 week, 9 hours, 1 minute, 52 seconds ago on Thursday, September 10, 2020.
Q: What are Deraghotels.de's nameservers?
A: DNS for Deraghotels.de is provided by the following nameservers:
  • ns81.domaincontrol.com
  • ns82.domaincontrol.com
Q: Who is the registrar for the Deraghotels.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Deraghotels.de?
A: Deraghotels.de ranks 613,663 globally on Alexa. Deraghotels.de has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Deraghotels.de each day?
A: Deraghotels.de receives approximately 1,546 visitors and 3,092 page impressions per day.
Q: What IP address does Deraghotels.de resolve to?
A: Deraghotels.de resolves to the IPv4 address 85.13.149.105.
Q: In what country are Deraghotels.de servers located in?
A: Deraghotels.de has servers located in the Germany.
Q: What webserver software does Deraghotels.de use?
A: Deraghotels.de is powered by Apache webserver.
Q: Who hosts Deraghotels.de?
A: Deraghotels.de is hosted by Neue Medien Muennich GmbH in Germany.
Q: How much is Deraghotels.de worth?
A: Deraghotels.de has an estimated worth of $2,400. An average daily income of approximately $10, which is roughly $304 per month.

Deraghotels.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Deraghotels.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Deraghotels.de

H1 Headings

1 :
  1. Living Hotels® entdecken

H2 Headings

5 :
  1. Angebote
  2. News
  3. Did You Know
  4. #Livingmoments
  5. We Like!

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

59 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-147638-1

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

94:

Links - Outbound (nofollow)

0:

Keyword Cloud for Deraghotels.de

hotel kaiser franzwesternkontaktmitteservicedmediciweimarfacebook instagramfreundlichesnamesiehtmldiv documentgetelementbyidrspluginsettingsinlinecssprinzessinpremier grandhotelsunselse var htmldivfranzfrankfurt mnchenolympiaparkhotel kaiserhtmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0wohnendemsindimifhtmldiv htmldivinnerhtml htmldivinnerhtmlwofr wirdaskanzlerfirmenkundenrelocationbesthotel russischerdocumentgetelementbyidrspluginsettingsinlinecssgrnenihnendocumentcreateelementdiv htmldivinnerhtmlifhtmldiv htmldivinnerhtmlelsereservierungdeutschenpremiernichtsehroderwohnen auf zeitvonnrnbergdocumentgetelementsbytagnamehead0appendchildhtmldivchildnodes0istzubest western premierfalsereservierung impressum datenschutzliving hotel kaiser0das viktualienmarktsliderapartmentsnewsletterappartementsauch frgrandfrankfurtpresse unsere partnerwestern premier grandanmeldenfolgendsseldorfpremier grand hotelgroerdatenschutzpresse unseredocumentcreateelementdivwir stehenunsere partnernrnberg weimarserviced apartmentshtmldivinnerhtmlblog shopliving hotelssichsie uns facebookhtmldivinnerhtml htmldivinnerhtml htmldivcsserrormessagegrand hoteldirektbonnihrerhtmldivinnerhtml htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0bietenzumimpressum datenschutzjdankwirpartnermeinehtmldivinnerhtml htmldivcss elsediekontakt newsletterliving hotelvar htmldiv documentcreateelementdivmnchen amwofrwiehtmldiv documentcreateelementdiv htmldivinnerhtmlnewsletter anmeldenfolgen sieunserviktualienmarktwienreservierung impressumhtmldivcss else varampruhigesgutallefindenmitsie unsweienseeam deutschenauf zeithotelzimmerhtmldiv documentcreateelementdivvar htmldiv documentgetelementbyidrspluginsettingsinlinecssunserentagenhierfrpartner kontaktkarrieremeine reservierung impressumvar htmldivcsscafsimpressumstehenbei unsmeine reservierungnewsletter blogactionsanmeldenfolgen sievarappartements johannauchhtmldivkaiser franzmodernesevents karrierepressedenaufunsereuns facebook instagramyoumehrpersonalaushtmldivinnerhtml htmldivinnerhtmlincludeflexiblenewsletter blog shoprussischersie diederifhtmldivgrand hotel russischerhtmldivinnerhtml htmldivcssjohannfunctionkaiserhotelbeikontakt newsletter bloghtmldivcssrevolutionbest westernwofr wir stehenunsere partner kontaktzeitvar htmldivhotel daselse varzimmer2relocation tagenlebender operwohnen aufuns facebookactioneinshopwestern premierberlinlassenunsererim livingnewsletter anmeldenfolgenevents1htmldivcss elsefreundliches personaldocumentcreateelementdiv htmldivinnerhtml htmldivcssim living hoteloperapartmentpartner kontakt newsletterberlin mittefacebooknachhaltigkeitinstagramanmeldenfolgen sie unsblogmnchenamliving

Longtail Keyword Density for Deraghotels.de

KeywordsOccurences
im living hotel6
wofr wir stehen4
wohnen auf zeit4
partner kontakt newsletter3
ifhtmldiv htmldivinnerhtml htmldivinnerhtml3
hotel kaiser franz3
living hotel kaiser3
unsere partner kontakt3
htmldivinnerhtml htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes03
documentcreateelementdiv htmldivinnerhtml htmldivcss3
htmldiv documentcreateelementdiv htmldivinnerhtml3
var htmldiv documentcreateelementdiv3
else var htmldiv3
htmldivcss else var3
htmldivinnerhtml htmldivcss else3
htmldivinnerhtml htmldivinnerhtml htmldivcss3
var htmldiv documentgetelementbyidrs-plugin-settings-inline-css3
kontakt newsletter blog3
presse unsere partner3
meine reservierung impressum3
uns facebook instagram3
sie uns facebook3
anmeldenfolgen sie uns3
newsletter anmeldenfolgen sie3
grand hotel russischer3
premier grand hotel3
western premier grand3
best western premier3
newsletter blog shop3
reservierung impressum datenschutz3
living hotel15
living hotels11
serviced apartments8
im living6
htmldivinnerhtml htmldivcss6
var htmldiv6
auf zeit5
kaiser franz5
mnchen am4
freundliches personal4
auch fr4
wofr wir4
sie uns4
wohnen auf4
frankfurt mnchen4
wir stehen4
relocation tagen4
events karriere4
partner kontakt3
kontakt newsletter3
htmldivcss else3
else var3
htmldiv documentcreateelementdiv3
documentcreateelementdiv htmldivinnerhtml3
htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes03
nrnberg weimar3
unsere partner3
ifhtmldiv htmldivinnerhtml3
bei uns3
presse unsere3
sie die3
hotel das3
hotel kaiser3
htmldivinnerhtml htmldivinnerhtml3
var htmldivcss3
am deutschen3
der oper3
das viktualienmarkt3
best western3
western premier3
premier grand3
grand hotel3
hotel russischer3
appartements johann3
newsletter anmeldenfolgen3
htmldiv documentgetelementbyidrs-plugin-settings-inline-css3
anmeldenfolgen sie3
berlin mitte3
blog shop3
facebook instagram3
meine reservierung3
reservierung impressum3
impressum datenschutz3
newsletter blog3
uns facebook3
hotel32
living29
sie26
der19
var18
die16
hotels14
fr14
apartments13
im13
uns13
unsere12
mnchen12
berlin11
wir11
zimmer10
das10
htmldivcss9
function9
htmldivinnerhtml9
wien8
ein8
serviced8
auch7
aus7
dsseldorf7
am7
zeit6
oder6
wie6
htmldiv6
newsletter6
sehr6
errormessage6
frankfurt6
sich6
auf6
bei6
amp6
firmenkunden5
mehr5
mit5
bieten5
franz5
kaiser5
unseren5
weimar5
von5
ihnen5
wohnen5
blog5
wofr4
stehen4
ihrer4
hotelzimmer4
j4
den4
unserer4
nrnberg4
alle4
04
flexible4
direkt4
else4
relocation4
freundliches4
dem4
ist4
apartment4
karriere4
events4
viktualienmarkt4
bonn4
zu4
unser4
gut4
tagen4
personal4
action3
include3
actions3
you3
dank3
slider3
revolution3
13
name3
ruhiges3
nicht3
grnen3
cafs3
sind3
modernes3
shop3
leben3
deutschen3
grand3
premier3
western3
best3
kontakt3
olympiapark3
prinzessin3
russischer3
johann3
appartements3
medici3
kanzler3
weiensee3
mitte3
groer3
partner3
presse3
nachhaltigkeit3
ifhtmldiv3
zum3
lassen3
finden3
hier3
false3
documentgetelementsbytagnamehead0appendchildhtmldivchildnodes03
documentcreateelementdiv3
documentgetelementbyidrs-plugin-settings-inline-css3
oper3
datenschutz3
impressum3
reservierung3
meine3
instagram3
facebook3
anmeldenfolgen3
23

Who hosts Deraghotels.de?

Deraghotels.de Hosting Provider Information

Hosted IP Address:85.13.149.105
Hosted Hostname:dd31536.kasserver.com
Service Provider:Neue Medien Muennich GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Apache

Is "Neue Medien Muennich GmbH" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
Neue Medien Muennich GmbH
0.1856%

HTTP Header Analysis for Deraghotels.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 07 Nov 2020 02:45:03 GMT
Server: Apache
Last-Modified: Fri, 06 Nov 2020 21:59:09 GMT
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html

Deraghotels.de Domain Nameserver Information

HostIP AddressCountry
ns81.domaincontrol.com 97.74.101.32
ns82.domaincontrol.com 173.201.69.32


Need to find out who hosts Deraghotels.de?


Domain Registration (WhoIs) information for Deraghotels.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: deraghotels.de
Nserver: ns81.domaincontrol.com
Nserver: ns82.domaincontrol.com
Status: connect
Changed: 2020-09-10T15:26:55+02:00

Websites with Similar Names

Deraga.com
Félicitations ! Votre domaine a bien été créé chez OVH !
Deragentur.net
423 Locked
Deraghazikhan.pk
Dera Ghazi Khan – My DGK Blog
Deraghcampbell.com
HugeDomains.com
Deraghotels.de
Serviced Apartments in Deutschland & Österreich | Living Hotels
Deraghul.site
devhackery (Raghul ) · GitHub
Deragisch2016.com
ERIC + MISSY
Deragonfordlincoln.com
辭頑悽縺ァ閼ア豈帙☆繧九↑繧峨♀縺吶☆繧√し繝ュ繝ウ縺ッ縺ゥ縺難シ溘さ繧ウ

Recently Updated Websites

Nocheflamenca.com (2 seconds ago.)Sagora.uno (3 seconds ago.)Virtualrealityjourneys.com (3 seconds ago.)Dyrema.cz (3 seconds ago.)Artbynatasha.com (5 seconds ago.)Caelanrowanmccuen.com (6 seconds ago.)Spanishmattressdeals.com (6 seconds ago.)Highwindllc.com (6 seconds ago.)Tomasfernandez.wine (7 seconds ago.)Cakemonkeybakery.com (7 seconds ago.)Oldbaltimorecrabhouse.com (7 seconds ago.)Epidermolysisbullosatreatment.org (7 seconds ago.)Fineartphonecases.com (8 seconds ago.)Dropcar.xyz (8 seconds ago.)Ism-agencement.com (8 seconds ago.)Crondallweather.co.uk (8 seconds ago.)Clotmag.com (8 seconds ago.)Fourleafdesign.media (10 seconds ago.)Morganhurricanelawyers.com (10 seconds ago.)Charlesgilchrist.com (10 seconds ago.)Narrowshapedisplayshopforskolin.com (11 seconds ago.)Onairaustin.com (12 seconds ago.)Mlbbmasters.com (12 seconds ago.)Paranormalsolutions.com (12 seconds ago.)Oswaldogonzalez.top (13 seconds ago.)Howellracing.com (13 seconds ago.)Thatelection.com (14 seconds ago.)Ayzchen.com (15 seconds ago.)Bed-rockconstruction.com (15 seconds ago.)Sanjabi.info (15 seconds ago.)

Recently Searched Keywords

ill take (1 second ago.)woodz(조승연) (2 seconds ago.)world heal (4 seconds ago.)flex-griditem--1525912530555-1 min-height (4 seconds ago.)colaba escorts (5 seconds ago.)37 116 0 (6 seconds ago.)mpulabs (7 seconds ago.)linh muc nguyen sang (8 seconds ago.)font-size 20px font-family (8 seconds ago.)zakłady live (9 seconds ago.)letters from the west (9 seconds ago.)english premier league free transfer list (10 seconds ago.)08123002260 (12 seconds ago.)data-slice-typecountdown countdown-contentdata-formatnumeric (14 seconds ago.)program khusus diet (14 seconds ago.)רכב פנאי 2020 (15 seconds ago.)胖哥蜗居把美乳骚老婆搞的高潮疯 (16 seconds ago.)100 padding 18px (17 seconds ago.)光热 (17 seconds ago.)*пайпер бим (17 seconds ago.)lycium chinense exotic (18 seconds ago.)different needs from wants and give examples (19 seconds ago.)rgba175250771 (20 seconds ago.)flyways audubon follows (21 seconds ago.)55 var (22 seconds ago.)max-width calc1260px 40px (23 seconds ago.)impregrace a äisticã­ prostå™edky (23 seconds ago.)みちのく (24 seconds ago.)2 058-u002fmn 120 (24 seconds ago.)granted by greenbrier (25 seconds ago.)