Derrymuseum.org

Website Thumbnail
Checking...
Derry History Museum

Safety: Low trust score
Year Founded: 2018
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-24
Category: This site has not been categorized yet


Domain summary

Domain label
derrymuseum
Domain extension
org
Domain registered:
2018-08-27
Domain updated:
2020-10-24
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is derrymuseum.org ranked relative to other sites:

Percentage of visits to derrymuseum.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Derrymuseum.org registered?
A: Derrymuseum.org was registered 2 years, 3 months, 6 days, 5 hours, 34 minutes, 56 seconds ago on Monday, August 27, 2018.
Q: When was the WHOIS for Derrymuseum.org last updated?
A: The WHOIS entry was last updated 1 month, 1 week, 2 days, 5 hours, 34 minutes, 56 seconds ago on Saturday, October 24, 2020.
Q: What are Derrymuseum.org's nameservers?
A: DNS for Derrymuseum.org is provided by the following nameservers:
  • ns1.hover.com
  • ns2.hover.com
Q: Who is the registrar for the Derrymuseum.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Derrymuseum.org?
A: Derrymuseum.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Derrymuseum.org each day?
A: Derrymuseum.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Derrymuseum.org resolve to?
A: Derrymuseum.org resolves to the IPv4 address 64.98.145.30.
Q: In what country are Derrymuseum.org servers located in?
A: Derrymuseum.org has servers located in the Canada.
Q: What webserver software does Derrymuseum.org use?
A: Derrymuseum.org is powered by Squarespace webserver.
Q: Who hosts Derrymuseum.org?
A: Derrymuseum.org is hosted by Tucows.com Co. in Canada.
Q: How much is Derrymuseum.org worth?
A: Derrymuseum.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Derrymuseum.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Derrymuseum.org Free SEO Report

Website Inpage Analysis for Derrymuseum.org

Keyword Cloud for Derrymuseum.org

socialiconssizelargesocialiconsstylesolidsoundcloudhoverlisqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover dribbblehoveractionssqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover twitchdataslicetypesocialiconshover vevohoverinputtypepasswordmozplaceholdercolorfffsqsslidewrapperdataslidetypecoverpagesqsslidewrapperdataslidetypecoverpageasqsslidewrapperdataslidetypecoverpageul lisqsslidewrapperdataslidetypecoverpageapplepodcasthoverdataslicetypealbum trackprogressbardataslicetypesocialicons rdiosqsslidewrapperdataslidetypecoverpage dataslicetypecountdown countdowncontentdataformatnumericdataslicetypesocialiconshover tumblrhoversqsslicealbumplaylist tracks trackdataslicetypesocialiconshover dropboxhover2stweethandlesqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangleeaseinotransitionopacity 2sbuttonsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlineuseiconfillff4500sqsslidewrapperdataslidetypecoverpageuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoveruseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoversqsslidecontainerdataslidetypepopupoverlayoverlayalignmentleftdataslicetypealbumdataslicetypesocialicons linkediniconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstyleknockout2s easeinmoztransitionopacity 2sresponsivewrapperstacked dataslicetypebuttons ulbuttontypesubmitsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons snapchatsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenablediconwrapperdivwebkittransformscale2moztransformscale2mstransformscale2transformscale2sqsslidewrapperdataslidetypecoverpagesqsalbumminimaldataslicetypealbum sqsslicealbumplayliststackedsocialiconsstylesolid dataslicetypesocialiconsdataslicetypebuttons ulstackedbuttonstyleoutlinesqsmodallightbox formwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleraiseddataslicetypesocialicons thedotssocialstacked dataslicetypesocialiconsdataslicetypesocialicons smugmugdataslicetypesocialiconshover imdbhoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstyleknockoutsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrappergmnoprintdataslicetypesocialiconshover tidaldataslicetypesocialiconshover facebookhoveruseiconfillf94877sqsslidewrapperdataslidetypecoverpagesqsslicecustomform asqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons redditdataslicetypesocialiconshover thedots0sqsslidewrapperdataslidetypecoverpagedataslicetypebuttonssqsslidewrapperdataslidetypecoverpagelockstylesoliddropboxhoverresponsivewrapperstacked sqsslicecustomformdataslicetypesocialiconshover reddituseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolidvscodataslicetypesocialicons spotifydataslicetypesocialicons rssusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconseaseinoutmstransitionbackgroundcolor 170ms easeinoutotransitionbackgroundcolorinstagrampasswordstyleunderlined dataslicetypepassworddataslicetypealbum sqsslicealbumplaylistplayingsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled datacompoundtypepopupoverlayaction1sdataslicetypecountdown countdowncontentdataformatnumericgoodreadsdataslicetypecountdownpinteresteaseintransitionopacityuseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverdataslicetypesocialicons behancetweetavatariconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstylesoliddataslicetypesocialiconshoversqsalbumminimal dataslicetypealbumdataslicetypesocialicons facebookeaseinout bordercoloruldataslicetypesocialiconshover vinedataslicetypesocialiconshover squarespaceeasesqsslidewrapperdataslidetypecoverpage170ms easeinoutmoztransitionbackgroundcolor 170msuseiconfill3b5998sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover instagramhoversocialiconsstylesoliddataslicetypealbum sqsslicealbumplaylistdataslicetypesocialicons imdbtracksfacebookhoveruseiconfill35465dsqsslidewrapperdataslidetypecoverpagesqsslidewrapperdataslidetypecoverpage dataslicetypebuttonsuseiconfillfffsqsslidewrapperdataslidetypecoverpage170ms easeinoutotransitionbackgroundcolor 170msuseiconfill4183c4sqsslidewrapperdataslidetypecoverpageiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstyleknockoutsquarespacehoverdataslicetypesocialiconshover houzzhoverdataslicetypesocialicons mediumdataslicetypesocialiconshover bandsintownhoveruseiconfill006ed2sqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleauto dataslicetypebuttons170ms easeinouttransitionbackgroundcoloreaseinoutsqsslidewrapperdataslidetypecoverpage socialiconsstylesolidusemaskfilltransparentsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover fivehundredpixhoversocialiconssizesmallsocialiconsstyleknockoutsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttons liuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsdataslicetypesocialiconshover youtubehoverdataslicetypesocialiconshover rdioeaseinoutotransitioncolordataslicetypesocialicons codepeneaseinoutsocialiconssizelargesocialiconsstyleregulargoogleinputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutline datacompoundtypepopupoverlayactiondataslicetypesocialicons foursquarebuttonstyleoutline dataslicetypebuttonsfacebookdataslicetypealbum iconwrapperlastchildsqsslidewrapperdataslidetypecoverpageshowtracktitle sqsalbumminimal60pxdataslicetypesocialiconshover iconwrappershowtracktitleuseiconfillff0031sqsslidewrapperdataslidetypecoverpagesvgsocialwebkittransitionbackgroundcolor 170msuseiconfille6b91esqsslidewrapperdataslidetypecoverpageuseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstylesolidasqsslidewrapperdataslidetypecoverpage buttonstyleoutline sqsslicecustomformsqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlineduseiconfillba923bsqsslidewrapperdataslidetypecoverpagemeetup2s 2sdataslicetypealbum iconwrapper170ms easeinoutmoztransitionbackgroundcolorvideoiconstylesolidsqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangle datacompoundtypepopupoverlayactioniconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstyleknockout0 0sqsslidewrapperdataslidetypecoverpagesocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverulstackediconwrapperwidth28pxheight28pxmargin0easeinouttransitionbackgroundcolorsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrappernothiddendataslicetypesocialiconshover googleplayhover6pxdataslicetypesocialicons stitcherdataslicetypesocialiconshover medium2s easeinotransitionopacitysqsslidecontainerdataslidetypepopupoverlaybuttonstyleoutline datacompoundtypepopupoverlayactionuseiconfill222sqsslidewrapperdataslidetypecoverpagederry0dataslicetypesocialiconshover yelpdribbblehoverdataslicetypealbum sqsslicealbumplaylistdemoalbumiconwrapperlastchildmarginright0sqsslidewrapperdataslidetypecoverpageusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutaudioplayericonsstyleborder dataslicetypealbumsocialiconsstylesolid dataslicetypesocialiconshover iconwrappersqsslidecontainerdataslidetypepopupoverlay captchacontainerwrapperdataslicetypesocialicons googleplaytidalsqsmodallightboxopendataslicetypesocialiconshover ituneshovereaseinoutotransitionbackgroundcolor 170msdataslicetypesocialicons vscodataslicetypesocialiconshover reddithovertwitchdataslicetypesocialicons githubactionsnotstackediconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstylesoliddataslicetypealbumhoverall and maxwidth1020pxtrackprogressbardataslicetypebuttons asqsslidewrapperdataslidetypecoverpagedribbbletumblrmediumhoverautoflex1sqssliceplaybuttoniconwrapperinputtypesubmitsqsslidewrapperdataslidetypecoverpagenovhuseiconfilltransparentsqsslidewrapperdataslidetypecoverpageiconwrapperdataslicetypesocialicons vevodataslicetypesocialiconshover pinteresthoverdataslicetypealbumhover iconwrapperhover4pxall and maxwidth600pxsqsslidewrapperdataslidetypecoverpagebehancemaxwidth600pxsqsslidewrapperdataslidetypecoverpage2s easesqsslidewrapperdataslidetypecoverpageeaseinoutsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover vimeohoverp asqsslidewrapperdataslidetypecoverpageuseiconfillec4652sqsslidewrapperdataslidetypecoverpagebuttonsqsslidewrapperdataslidetypecoverpagelockstyleborderuseiconfillcc2127sqsslidewrapperdataslidetypecoverpagestumbleuponimdbhoversqsmodallightboxcontent lightboxinner lightboxcontentp2empinteresthovercountdowncontentdataformattextualdatacompoundtypepopupoverlayaction errormessagesqsslidewrapperdataslidetypecoverpageyelpdataslicetypebuttons ulasqsslidewrapperdataslidetypecoverpage buttonstyleoutlinebordercolor 170msdataslicetypepassword inputtypepasswordsqsslidewrapperdataslidetypecoverpageinstagramhoverli asqsslidewrapperdataslidetypecoverpageuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutsqsslicecustomformsqsslidewrapperdataslidetypecoverpagevimeo7pxinputtypetextsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypesocialiconshover twitterhoveractionsnotstacked inputwrappernothiddendataslicetypesocialiconshover githubsqsslicedatacontentemptytruedisplaynonesqsslidewrapperdataslidetypecoverpageusemaskfill222sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover spotifyuseiconfill1ea9e1sqsslidewrapperdataslidetypecoverpagecountdowncontentdataformattextual countdownunittracks trackredditsqsslicealbumplaylistplayingdataslicetypenavigation ul li2s easeinotransitionopacity 2sdataslicetypebuttons li asqsslidewrapperdataslidetypecoverpagedataslicetypebody pinputtypesubmithoversqsslidewrapperdataslidetypecoverpagesvgsocialwebkittransitionbackgroundcolorsocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovericonwrapperborder2pxsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlinesocialiconssizemediumsocialiconsstylesoliddataslicetypetwitternotdatacompoundtypedataslicetypesocialiconshover soundcloudhoversocialstackedtextalignleft dataslicetypesocialiconslightboxinner lightboxcontent formwrapper2s easeinmstransitionopacitydataslicetypesocialiconshover tumblrsqsslicealbumplaylistdemoalbumtidalhovereaseoutopacity 170msdataslicetypesocialicons tidalsqsalbumminimal dataslicetypealbum sqsslicealbumplaylistdataslicetypesocialicons fivehundredpixsvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolidiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstylesoliddataslicetypesocialiconshover vinehoveruseiconfill000sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstyleknockoutdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstylesolidpasswordstylerectangleeaseinoutmoztransitionbackgroundcolor 170ms easeinoutmstransitionbackgroundcolorcodepenhoverdataslicetypesocialiconshover vscohover3pxyelphover170ms easeoutopacitysocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconssocialiconsstyleborder dataslicetypesocialicons2s easeinmoztransitionopacitydataslicetypetwittereaseinoutmoztransitioncolordataslicetypealbum sqsslicealbumplaylist trackssocialstacked dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpagesocialiconsstyleknockout2em 0px 0pxsvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoveruseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregularformwrapperadisplayblocksqsslidewrapperdataslidetypecoverpagedataslicetypealbumhover iconwrapperbordercoloruseiconfill1ab7easqsslidewrapperdataslidetypecoverpagelockstyleknockoutuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesoliddataslicetypesocialicons squarespacefielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25emdataslicetypesocialiconshover codepenbuttonplaypauselidisclaimercontainersqsslidewrapperdataslidetypecoverpagedataslicetypepassword170ms easeoutopacity 170mseaseinouttransitionbackgroundcolor 170ms easeinoutsqsslidewrapperdataslidetypecoverpageahoversqsslidewrapperdataslidetypecoverpagesocialiconsstylesolid dataslicetypesocialiconshovericonwrapperwidth36pxheight36pxmargin0dataslicetypesocialiconshover emailhover0ms 0mssqsslidesqsslideanimationreadysocialiconssizeextrasmallsocialiconsstyleregular2em 0pxresponsivewrapperstacked dataslicetypebuttons ulsqsslidewrapperdataslidetypecoverpageerrormessagesqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleautosocialiconssizemediumsocialiconsstyleknockoutlightboxinnergithubhoversocialstackeddataslicetypegallerydataslicetypesocialiconshover iconwrapperhoverdataslicetypesocialiconshover twittersvgsocialwebkittransitionbackgroundcolor 170ms easeinoutmoztransitionbackgroundcoloraudioplayericonsstyleregularuseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregulardataslicetypesocialiconshover stitcherhoverli ahoversqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover rsshoverstitcherdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstyleknockout170ms easeinouttransitionbackgroundcolor 170msbordercolor 170ms easeinoutsqsslidewrapperdataslidetypecoverpagevinehoverdataslicetypesocialiconshover applepodcasthovervinesqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutlinedataslicetypenavigationalignmentcenterbuttonstylesoliddataslicetypebuttons ulsqsslidewrapperdataslidetypecoverpageresponsivewrapperstackedactionsstackedusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpagestumbleuponhoverdataslicetypebuttonsvideoiconstyleregularbuttonstyleoutline sqsslicecustomformuseiconfill00ab6csqsslidewrapperdataslidetypecoverpagearrowiconlockstyleregular dataslicetypelockfivehundredpixhoverdataslicetypesocialicons flickralignmentcenter responsivewrapperstackedsqsslicealbumplayliststackedvideoiconstylebordergalleryvideobackgroundonly screendataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstylesoliduseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpagesocialiconscolorstandardsocialiconsstyleknockoutdataslicetypesocialicons twitchsoundclouddataslicetypepassword arrowicondataslicetypesocialiconshover meetuphoverimportantsqsslidewrapperdataslidetypecoverpageresponsivewrapperstacked dataslicetypenavigation ulinputtypepasswordsqsslidewrapperdataslidetypecoverpage01sdataslicetypesocialicons yelpenablepagebordersqsslidecontainersqssliceplaybuttoniconwrappersqsslidewrapperdataslidetypecoverpagedataslicetypebodysqsslidewrapperdataslidetypecoverpage dataslicetypebodystitcherhover2s easeinmstransitionopacity 2sdataslicetypesocialiconshover soundcloudul li asqsslidewrapperdataslidetypecoverpageautosqsslidewrapperdataslidetypecoverpagedataslicetypegallery galleryvideobackgrounduseiconfill6441a5sqsslidewrapperdataslidetypecoverpagedataslicetypelocksocialiconssizeextralargesocialiconsstyleknockoutmaxwidth1020pxsqsslidewrapperdataslidetypecoverpageuseiconfill7ac143sqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaybuttonstyleoutlinedataslicetypesocialicons twittersocialstackedtextalignleft dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpagelightboxinner lightboxcontentaudioplayericonsstylebordercodepensmugmughoverresponsivewrappersocialiconssizesmallsocialiconsstylesolidulsqsslidewrapperdataslidetypecoverpagedataslicetypeheadingnotdatacompoundtypeiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstyleknockouteaseinmoztransitionopacitydataslicetypesocialiconshover facebookdataslicetypesocialiconshover rssdataslicetypesocialiconshover linkedinhoveritunesuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleborderdataslicetypesocialiconshover itunesdataslicetypesocialiconshover googlesqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutlinedataslicetypesocialiconshover meetupactionsstacked inputwrapperimportantsqsslidewrapperdataslidetypecoverpage sqsslidecontainernotautoimagebackgroundcoloriconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstylesolidvscohoversnapchathovermedium5pxspotifyhoveruseiconfille52d27sqsslidewrapperdataslidetypecoverpagepasswordstylerectangle dataslicetypepasswordsocialiconssizeextrasmallsocialiconsstyleborderdataslicetypesocialiconshover bandsintowngoogleplaybuttonsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackeddataslicetypesocialiconshover fivehundredpixtwitchhoverformwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutlineyoutubeusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverdataslicetypetwitternotdatacompoundtype tweetbodydataslicetypesocialiconshover vscodataslicetypesocialiconshover stitcherdataslicetypesocialicons dropboxul lidataslicetypebodylockstylesolid dataslicetypelockeaseinoutmstransitionbackgroundcolorapplepodcastlockstyleknockout dataslicetypelockuseiconfilldc4e41sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover stumbleuponsolidfielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25em 5emfont14pxgmstylecc170ms easeinoutmstransitionbackgroundcolor 170msthedotshoverdataslicetypebuttons ul lidataslicetypesocialicons goodreadsuseiconfill55aceesqsslidewrapperdataslidetypecoverpagetwitterhovermeetuphover8pxsocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverdataslicetypesocialicons youtubelinkedindataslicetypesocialiconshover googleplaydataslicetypebuttons lidataslicetypesocialicons usemaskfilltransparentsqsslidewrapperdataslidetypecoverpage0px 0pximdbuseiconfill7dbb00sqsslidewrapperdataslidetypecoverpagedataslicetypealbum iconwrapperlastchildmarginright0sqsslidewrapperdataslidetypecoverpagesocialiconscolorstandardsocialiconsstylesolidsvgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypecoverpageeaseinoutmstransitionbackgroundcolor 170msasqsslidewrapperdataslidetypecoverpage dataslicetypetwittersocialstackedtextalignleftuseiconfill0063dcsqsslidewrapperdataslidetypecoverpagethedotsformwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpagebuttonstyleoutlinedataslicetypesocialicons svgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypecoverpageeaseinout bordercolor 170ms170ms easeinout bordercolordataslicetypesocialiconshover linkedindatacompoundtypepopupoverlayaction buttontypesubmitsqsslidewrapperdataslidetypecoverpagedataslicetypebuttons ul lisqsslidewrapperdataslidetypecoverpage170ms easeinoutmstransitionbackgroundcolorsqsslicecustomformlightboxcontent formwrappervimeohoversocialiconssizeextralargesocialiconsstyleregulareaseinmoztransitionopacity 2seaseinoutmstransitioncoloralleaseinmstransitionopacity 2ssqsmodallightboxcontent0pxdropboxsocialiconsstyleborderdatacompoundtypelogouseiconfill00b4b3sqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlined datacompoundtypepopupoverlayactiondataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstylesolidsqsslidecontainerdataslidetypepopupoverlayenableoverlaycontentborderyoutubehoveravisitedsqsslidewrapperdataslidetypecoverpagedataslicetypebuttons li ahoversqsslidewrapperdataslidetypecoverpage14pxfoursquarehoversqsslidelayercontent10pxdataslicetypesocialiconshover codepenhoverp ahoversqsslidewrapperdataslidetypecoverpagecaptchacontainerwrapperdataslicetypesocialiconshover thedotshoverlockstyleregulartweettimestampdataslicetypesocialiconshover snapchatdataslicetypesocialiconshover foursquarehoverinputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover vevodataslicetypesocialicons emailalignmentrightsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttonssqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineauto dataslicetypebuttonsdataslicetypesocialiconshover behancehovereaseinoutmoztransitionbackgroundcolor 170ms100msbuttonshaperoundedcornersbandsintownhovertumblrhoverdataslicetypesocialiconshover rdiohovereaseinmstransitionopacitydataslicetypesocialiconshover mediumhoverituneshoverfoursquaresvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpagelightboxcontentdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstylesoliddataslicetypesocialicons soundclouddataslicetypesocialiconshover smugmugdataslicetypemap gmstylecciconwrapperhoverspotifyeaseintransitionopacity 2seaseinoutotransitionbackgroundcolordataslicetypetwitternotdatacompoundtype tweettimestampdataslicetypesocialicons googledataslicetypesocialiconshover foursquareflickrhovergalleryvideobackgroundmobiledataslicetypesocialicons itunes5emfont14pxformwrapper inputtypesubmithoversqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover pinteresteaseinoutotransitionbackgroundcolor 170ms easeinouttransitionbackgroundcolorsocialiconssizeextralargesocialiconsstyleborderusebackgroundfillfffsqsslidewrapperdataslidetypecoverpageemailhoverdataslicetypecountdown countdowncontentdataformattextualdataslicetypebodysqsslidewrapperdataslidetypecoverpagesocialiconsstyleregular dataslicetypesocialiconssocialiconssizeextralargesocialiconsstylesolidsqsslicealbumplaylist tracksdataslicetypesocialiconshover dribbbleuseiconfillfffbackgroundcolorfffsqsslidewrapperdataslidetypecoverpagevideoiconstyleknockoutdataslicetypesocialiconshover behancedataslicetypesocialicons dribbblebuttonstyleoutlinesqsmodallightboxuseiconfill007ee5sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover smugmughovergooglehoversqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineautoall and maxwidth1020pxsqsslidewrapperdataslidetypecoverpage1pxiconwrapperwidth24pxheight24pxmargin0alignmentright responsivewrapperstackedaudioplayericonsstyleregular dataslicetypealbumsqsalbumminimal dataslicetypealbum sqsslicealbumplayliststackeddataslicetypebuttons ahoversqsslidewrapperdataslidetypecoverpagesocialiconssizeextrasmallsocialiconsstylesolidsqsmodallightboxformitemsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlineuseiconfillf60sqsslidewrapperdataslidetypecoverpagersshoversqsslidecontainerdataslidetypepopupoverlay datacompoundtypepopupoverlayactionsmugmuglightboxcontent formwrapper pdataslicetypemapuseiconfille4405fsqsslidewrapperdataslidetypecoverpagerdiosocialiconssizemediumsocialiconsstyleregularrssdataslicetypesocialiconshover githubhoveruseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialicons0mseaseinouttransitionbackgroundcolor 170msdataslicetypebuttons lisqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover yelphover2s easeintransitionopacityhouzzhoversvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverpasswordstyleunderlinedaudioplayericonsstyleknockoutinputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutlinesqsalbumminimal dataslicetypealbum sqsslicealbumplaylistdemoalbumdataslicetypetwitter tweetavatardataslicetypesocialiconshover instagrambuttonshapepilldataslicetypesocialiconshover stumbleuponhoversvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconssqsslidewrapperdataslidetypecoverpage dataslicetypecountdowntwittersqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutline datacompoundtypepopupoverlayactiondataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebody pdataslicetypealbum tracktitledataslicetypenavigation ulsqsslidecontainernotautoimagebackgroundcolordataslicetypesocialicons bandsintownsocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconsdataslicetypesocialiconshover snapchathoversqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstackedshowtracktitle sqsalbumminimal dataslicetypealbumdataslicetypegallery galleryvideobackgroundmobiledatacompoundtypepopupoverlayaction inputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypecoverpagemapstyleminimaldarkdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstyleknockoutusebackgroundfilltransparentsqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstacked inputwrappernothiddenaudioplayericonsstylesolidrdiohoveruseiconfill5adfcbsqsslidewrapperdataslidetypecoverpagesvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregularuseiconfill0099e5sqsslidewrapperdataslidetypecoverpageonlydataslicetypesocialiconshover goodreadshoveruseiconfillc41200sqsslidewrapperdataslidetypecoverpagetracktitlesocialiconssizemediumsocialiconsstylebordersnapchat170ms easeinoutsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover youtubesocialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconssocialiconscolorstandardsocialiconsstyleregularsocialiconscolorstandardsocialiconsstylebordervevouseiconfillae995asqsslidewrapperdataslidetypecoverpagesqsslidewrapperdataslidetypecoverpage responsivewrappernotstackedgoogleplayhoverdataslicetypepassword inputtypepasswordmozplaceholdercolorfffsqsslidewrapperdataslidetypecoverpage170ms easeinoutotransitionbackgroundcolorformitemsqsslidewrapperdataslidetypecoverpageusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutcountdowncontentdataformatnumericsocialiconsstylesolid dataslicetypesocialiconshover iconwrapperhoversvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpagedataslicetypecountdown countdowncontentdataformattextual countdownunitdataslicetypegallerysqsgallerygridsqsslicealbumplaylistbehancehoverdatacompoundtypepopupoverlayactionsqsslidecontainerdataslidetypepopupoverlayoverlayalignmentcentersqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinline dataslicetypebuttonsdataslicetypemap gmnoprintformwrapper psqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinemaxwidth1020pxsqsslicecustomform spansqsslidewrapperdataslidetypecoverpagefivehundredpixresponsivewrapperstacked dataslicetypebuttonssocialiconssizesmallsocialiconsstylebordersqssliceplaybuttoniconwrapperhoverneuearialsansseriffontweightnormalfontstylenormalletterspacing6pxsqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackeddataslicetypesocialicons vimeodataslicetypesocialiconshover goodreadsspansqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons vinesocialiconssizelargesocialiconsstyleknockoutinputwrapperinputtypetextsqsslidewrapperdataslidetypecoverpagetweetdisplaynamedataslicetypesocialicons pinterestsocialiconssizeextrasmallsocialiconsstyleknockoutsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebodysqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestacked inputwrapperdataslicetypesocialiconshover houzzsocialiconssizesmallsocialiconsstyleregulardataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstylesolidactionsstacked inputwrappernothiddenuseiconfill382110sqsslidewrapperdataslidetypecoverpagebuttonstyleoutlinesqsmodallightbox formwrappereaseoutopacityuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconseaseinoutmoztransitionbackgroundcoloruseiconfille0393esqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlayoverlayloadanimationslidein2s easeintransitionopacity 2sdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstyleknockoutgoodreadshovereaseinouttransitioncolorresponsivewrappernotstackeddataslicetypealbum iconwrappersqsslidewrapperdataslidetypecoverpageuseiconfilleb4924sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover spotifyhoveruseiconfill8c8070sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover tidalhovercountdownuniticonwrapperwidth32pxheight32pxmargin0dataslicetypesocialiconshover googlehoverdataslicetypesocialicons houzzsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestackedgithubsqsslidelayersplitfiftysquarespaceuseiconfill1769ffsqsslidewrapperdataslidetypecoverpageflickrdataslicetypesocialiconshover twitchhoverinputwrappernothidden170ms easeinoutdataslicetypesocialicons applepodcastscreenimportantsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypesocialicons tumblr170msuseiconfillea4c89sqsslidewrapperdataslidetypecoverpagedatacompoundtypepopupoverlayaction inputtypetextsqsslidewrapperdataslidetypecoverpagesqsmodallightboxcontent lightboxinnerdataslicetypesocialicons instagramlockstyleborder dataslicetypelockresponsivewrapperstacked dataslicetypenavigationdataslicetypelock usebackgroundfilltransparentsqsslidewrapperdataslidetypecoverpagebuttonstyleraised1houzzdisplaytablesqsslidewrapperdataslidetypecoverpagetweetbodydataslicetypesocialiconshover emailsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolidreddithoveraudioplayericonsstylesolid dataslicetypealbumhovervevohoverscreen and maxwidth600pxsqsslidewrapperdataslidetypecoverpageiconwrapperlastchildsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover flickrhoversocialiconsstyleregulardataslicetypesocialicons meetupusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolidsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline datacompoundtypepopupoverlayactionuseiconfill0976b4sqsslidewrapperdataslidetypecoverpagetrackdataslicetypesocialiconshover dropboxuseiconfill00b488sqsslidewrapperdataslidetypecoverpagesqsslicecustomform ahoversqsslidewrapperdataslidetypecoverpagebandsintownuseiconfill84bd00sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover imdbdataslicetypesocialicons stumbleuponeaseinotransitionopacitylinkedinhoveruseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpagesocialiconssizelargesocialiconsstylebordersocialiconsstyleknockout dataslicetypesocialiconsiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstyleknockoutemaildataslicetypesocialiconsresponsivewrapperstackedtextaligncenterdataslicetypesocialiconshover applepodcastdataslicetypesocialiconshover squarespacehoversocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsdataslicetypesocialiconshover flickriconwrappersqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover vimeo

Longtail Keyword Density for Derrymuseum.org

KeywordsOccurences
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons44
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
sqs-modal-lightbox-content lightbox-inner lightbox-content19
170ms ease-in-out border-color15
ease-in-out border-color 170ms15
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlist14
lightbox-inner lightbox-content form-wrapper14
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons12
data-slice-typealbum sqs-slice-album-playlist tracks11
socialstackedtext-align-left data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
socialstacked data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
170ms ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-outtransitionbackground-color 170ms8
170ms ease-in-out-moz-transitionbackground-color 170ms8
sqs-slice-album-playlist tracks track7
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons6
2em 0px 0px6
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
show-track-title sqs-album-minimal data-slice-typealbum6
data-slice-typebuttons ul lisqs-slide-wrapperdata-slide-typecover-page6
ease-in-outtransitionbackground-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page6
ease-in-out-o-transitionbackground-color 170ms ease-in-outtransitionbackground-color6
responsive-wrapperstacked data-slice-typenavigation ul6
ease-in-out-ms-transitionbackground-color 170ms ease-in-out-o-transitionbackground-color6
ease-in-out-moz-transitionbackground-color 170ms ease-in-out-ms-transitionbackground-color6
data-slice-typebuttons li asqs-slide-wrapperdata-slide-typecover-page5
data-slice-typenavigation ul li5
responsive-wrapperstacked data-slice-typebuttons ul5
170ms ease-outopacity 170ms5
all and max-width1020px4
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapperhover4
data-slice-typebuttons ul li4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons li4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody p4
svgsocial-webkit-transitionbackground-color 170ms ease-in-out-moz-transitionbackground-color4
lightbox-content form-wrapper p4
all and max-width1020pxsqs-slide-wrapperdata-slide-typecover-page4
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked input-wrappernothidden4
all and max-width600pxsqs-slide-wrapperdata-slide-typecover-page4
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrapper3
buttonsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked3
sqs-slide-wrapperdata-slide-typecover-page data-slice-typecountdown countdown-contentdata-formatnumeric3
data-slice-typecountdown countdown-contentdata-formattextual countdown-unit3
data-slice-typebuttons li ahoversqs-slide-wrapperdata-slide-typecover-page3
button-style-outlinesqs-modal-lightbox form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrappernothidden3
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline3
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline data-compound-typepopup-overlay-action3
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapper3
responsive-wrapperstacked data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-solid3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playliststacked3
ul li asqs-slide-wrapperdata-slide-typecover-page3
2s ease-in-moz-transitionopacity 2s3
2s ease-in-ms-transitionopacity 2s3
2s ease-in-o-transitionopacity 2s3
2s ease-intransitionopacity 2s3
border-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlistdemo-album3
screen and max-width600pxsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-knockout3
asqs-slide-wrapperdata-slide-typecover-page button-style-outline sqs-slice-custom-form3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-knockout3
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover176
social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons176
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover88
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover88
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons88
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid88
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout44
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons44
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid44
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page34
sqs-album-minimal data-slice-typealbum25
sqs-modal-lightbox-content lightbox-inner21
socialstackedtext-align-left data-slice-typesocial-icons20
socialstacked data-slice-typesocial-icons20
lightbox-inner lightbox-content19
data-slice-typecountdown countdown-contentdata-formatnumeric18
border-color 170ms15
data-slice-typealbum sqs-slice-album-playlist15
170ms ease-in-out15
ease-in-out border-color15
lightbox-content form-wrapper14
data-slice-typegallery gallery-video-background14
data-slice-typebuttons ul14
170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page13
data-slice-typenavigation ul12
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-border12
sqs-slide-containerdata-slide-typepopup-overlay data-compound-typepopup-overlay-action12
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked12
sqs-slice-album-playlist tracks11
data-slice-typecountdown countdown-contentdata-formattextual11
0 0sqs-slide-wrapperdata-slide-typecover-page11
data-slice-typealbum icon-wrapper11
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked11
data-slice-typebuttons li10
data-slice-typealbum icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typecover-page10
data-slice-typealbum icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
data-slice-typealbum icon-wrapperlast-childsqs-slide-wrapperdata-slide-typecover-page10
password-style-underlined data-slice-typepassword10
responsive-wrapperstacked data-slice-typebuttons9
ul li9
li asqs-slide-wrapperdata-slide-typecover-page9
responsive-wrapperstacked data-slice-typenavigation9
password-style-rectangle data-slice-typepassword9
170ms ease-in-outtransitionbackground-color8
data-slice-typebody p8
data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typecover-page8
170ms ease-in-out-moz-transitionbackground-color8
ease-in-outtransitionbackground-color 170ms8
ease-in-out-moz-transitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color8
data-slice-typebuttons asqs-slide-wrapperdata-slide-typecover-page8
ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color8
ease-in-out-o-transitionbackground-color 170ms8
social-icons-style-solid data-slice-typesocial-iconshover8
ul lisqs-slide-wrapperdata-slide-typecover-page7
social-icons-style-border data-slice-typesocial-icons7
button-style-outlinesqs-modal-lightbox form-wrapper7
button-style-outline data-compound-typepopup-overlay-action7
show-track-title sqs-album-minimal7
sqs-slice-custom-form asqs-slide-wrapperdata-slide-typecover-page7
tracks track7
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-compound-typepopup-overlay-action6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline data-compound-typepopup-overlay-action6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle data-compound-typepopup-overlay-action6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
0px 0px6
audio-player-icons-style-border data-slice-typealbum6
data-slice-typealbum track-progress-bar6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout6
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page6
2em 0px6
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
button-style-outline sqs-slice-custom-form6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
data-slice-typesocial-iconshover icon-wrapperhover6
button-style-outline data-slice-typebuttons6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
data-slice-typesocial-icons itunes5
data-slice-typesocial-icons linkedin5
data-slice-typesocial-icons medium5
data-slice-typesocial-icons meetup5
data-slice-typesocial-icons imdb5
data-slice-typesocial-icons instagram5
data-slice-typesocial-icons goodreads5
data-slice-typesocial-icons google5
data-slice-typesocial-icons googleplay5
data-slice-typesocial-icons github5
data-slice-typesocial-icons foursquare5
data-slice-typesocial-icons flickr5
alignment-right responsive-wrapperstacked5
data-slice-typesocial-icons pinterest5
data-slice-typesocial-icons vimeo5
alignment-center responsive-wrapperstacked5
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined data-compound-typepopup-overlay-action5
lock-style-regular data-slice-typelock5
data-slice-typesocial-iconshover icon-wrapper5
ease-outopacity 170ms5
170ms ease-outopacity5
0ms 0ms5
data-slice-typesocial-icons youtube5
data-slice-typesocial-icons yelp5
data-slice-typesocial-icons facebook5
data-slice-typesocial-icons vsco5
data-slice-typesocial-icons vine5
data-slice-typesocial-icons vevo5
data-slice-typesocial-icons rdio5
data-slice-typesocial-icons twitter5
data-slice-typesocial-icons twitch5
data-slice-typesocial-icons tumblr5
data-slice-typesocial-icons tidal5
data-slice-typesocial-icons thedots5
data-slice-typesocial-icons stumbleupon5
data-slice-typesocial-icons stitcher5
data-slice-typesocial-icons squarespace5
data-slice-typesocial-icons spotify5
data-slice-typesocial-icons soundcloud5
data-slice-typesocial-icons snapchat5
data-slice-typesocial-icons smugmug5
data-slice-typesocial-icons rss5
data-slice-typesocial-icons reddit5
data-slice-typesocial-icons fivehundredpix5
data-slice-typesocial-icons houzz5
data-slice-typesocial-icons email5
2s 2s5
data-slice-typesocial-icons applepodcast5
data-slice-typesocial-icons bandsintown5
data-slice-typesocial-icons behance5
data-slice-typesocial-icons codepen5
sqs-slide-wrapperdata-slide-typecover-page data-slice-typebuttons5
data-slice-typealbum sqs-slice-album-playlistplaying5
data-slice-typesocial-icons dribbble5
asqs-slide-wrapperdata-slide-typecover-page button-style-outline5
data-slice-typesocial-icons dropbox5
data-slice-typepassword inputtypepassword-moz-placeholdercolorfffsqs-slide-wrapperdata-slide-typecover-page4
data-slice-typesocial-iconshover twitterhover4
data-slice-typesocial-iconshover twitter4
data-slice-typesocial-iconshover twitchhover4
data-slice-typesocial-iconshover email4
data-slice-typesocial-iconshover tumblrhover4
data-slice-typesocial-iconshover tumblr4
data-slice-typesocial-iconshover tidalhover4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-compound-typepopup-overlay-action4
data-slice-typesocial-iconshover tidal4
data-slice-typesocial-iconshover thedotshover4
data-slice-typesocial-iconshover stumbleuponhover4
data-slice-typesocial-iconshover thedots4
data-slice-typesocial-iconshover stumbleupon4
data-slice-typesocial-iconshover stitcherhover4
data-slice-typesocial-iconshover stitcher4
data-slice-typesocial-iconshover squarespacehover4
responsive-wrapperstacked sqs-slice-custom-form4
data-slice-typesocial-iconshover squarespace4
data-slice-typesocial-iconshover spotifyhover4
data-slice-typesocial-iconshover spotify4
data-slice-typesocial-iconshover soundcloudhover4
data-slice-typesocial-iconshover soundcloud4
data-slice-typesocial-iconshover vevo4
data-slice-typesocial-iconshover vevohover4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons4
data-compound-typepopup-overlay-action inputtypetextsqs-slide-wrapperdata-slide-typecover-page4
lock-style-border data-slice-typelock4
data-slice-typetwitternotdata-compound-type tweet-body4
data-slice-typealbumhover icon-wrapperhover4
data-slice-typealbumhover icon-wrapper4
audio-player-icons-style-solid data-slice-typealbumhover4
svgsocial-webkit-transitionbackground-color 170ms4
actionsnotstacked input-wrappernothidden4
buttonsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline4
form-wrapper p4
data-slice-typebuttons lisqs-slide-wrapperdata-slide-typecover-page4
data-slice-typesocial-iconshover youtubehover4
data-slice-typesocial-iconshover vimeo4
data-slice-typesocial-iconshover youtube4
data-slice-typesocial-iconshover yelphover4
data-slice-typesocial-iconshover yelp4
data-compound-typepopup-overlay-action inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typecover-page4
data-slice-typesocial-iconshover vscohover4
data-slice-typesocial-iconshover vsco4
data-slice-typesocial-iconshover snapchat4
data-slice-typesocial-iconshover vinehover4
data-slice-typesocial-iconshover vine4
data-slice-typesocial-iconshover vimeohover4
data-slice-typesocial-iconshover snapchathover4
data-slice-typesocial-iconshover twitch4
data-slice-typesocial-iconshover smugmughover4
data-slice-typesocial-iconshover codepen4
data-slice-typesocial-iconshover ituneshover4
data-slice-typesocial-iconshover itunes4
data-slice-typesocial-iconshover instagramhover4
data-slice-typesocial-iconshover instagram4
data-slice-typesocial-iconshover imdbhover4
data-slice-typesocial-iconshover imdb4
data-slice-typesocial-iconshover behancehover4
data-slice-typesocial-iconshover houzzhover4
data-slice-typesocial-iconshover houzz4
data-slice-typesocial-iconshover googlehover4
data-slice-typesocial-iconshover google4
data-slice-typesocial-iconshover fivehundredpix4
data-slice-typesocial-iconshover googleplayhover4
data-slice-typesocial-iconshover dropbox4
data-slice-typesocial-iconshover googleplay4
data-slice-typesocial-iconshover codepenhover4
data-slice-typesocial-iconshover goodreadshover4
data-slice-typesocial-iconshover fivehundredpixhover4
data-slice-typesocial-iconshover flickr4
data-slice-typesocial-iconshover flickrhover4
data-slice-typesocial-iconshover dribbblehover4
data-slice-typesocial-iconshover goodreads4
data-slice-typesocial-iconshover foursquare4
data-slice-typesocial-iconshover foursquarehover4
data-slice-typesocial-iconshover dribbble4
data-slice-typesocial-iconshover github4
data-slice-typesocial-iconshover bandsintownhover4
data-slice-typesocial-iconshover behance4
data-slice-typesocial-iconshover linkedin4
data-slice-typesocial-iconshover pinterest4
data-slice-typesocial-iconshover smugmug4
data-slice-typesocial-iconshover emailhover4
data-slice-typesocial-iconshover rsshover4
data-slice-typesocial-iconshover rss4
social-icons-style-regular data-slice-typesocial-icons4
data-slice-typesocial-iconshover reddithover4
data-slice-typesocial-iconshover dropboxhover4
data-slice-typesocial-iconshover reddit4
data-slice-typesocial-iconshover rdiohover4
data-slice-typesocial-iconshover linkedinhover4
data-slice-typesocial-iconshover facebook4
data-slice-typesocial-iconshover rdio4
data-slice-typesocial-iconshover applepodcast4
data-slice-typesocial-iconshover pinteresthover4
data-slice-typesocial-iconshover githubhover4
data-slice-typesocial-iconshover medium4
data-slice-typesocial-iconshover applepodcasthover4
data-slice-typesocial-iconshover meetuphover4
data-slice-typesocial-iconshover bandsintown4
data-slice-typesocial-iconshover mediumhover4
data-slice-typesocial-iconshover meetup4
data-slice-typesocial-iconshover facebookhover4
inputtypetextsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
li ahoversqs-slide-wrapperdata-slide-typecover-page3
lock-style-knockout data-slice-typelock3
data-slice-typetwitternotdata-compound-type tweet-timestamp3
data-slice-typelock use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typegallery gallery-video-backgroundmobile3
ease-in-ms-transitionopacity 2s3
actionsstacked input-wrappernothidden3
2s ease-in-ms-transitionopacity3
lock-style-solid data-slice-typelock3
sqs-slide-containerdata-slide-typepopup-overlay captcha-container-wrapper3
data-compound-typepopup-overlay-action error-messagesqs-slide-wrapperdata-slide-typecover-page3
ease-intransitionopacity 2s3
2s ease-in-moz-transitionopacity3
2s ease-intransitionopacity3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em 5emfont14px3
importantsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
social-icons-style-solid data-slice-typesocial-icons3
ease-in-o-transitionopacity 2s3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked input-wrapper3
2s ease-in-o-transitionopacity3
ease-in-moz-transitionopacity 2s3
actionsstacked input-wrapper3
importantsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containernotauto-image-background-color3
form-itemsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
data-slice-typebodysqs-slide-wrapperdata-slide-typecover-page data-slice-typebody3
social-icons-style-knockout data-slice-typesocial-icons3
data-slice-typepassword arrow-icon3
ease-in-outsqs-slide-wrapperdata-slide-typecover-page social-icons-style-solid3
sqs-slice-custom-form spansqs-slide-wrapperdata-slide-typecover-page3
data-compound-typepopup-overlay-action buttontypesubmitsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typetwitter tweet-avatar3
asqs-slide-wrapperdata-slide-typecover-page data-slice-typetwitter3
data-slice-typepassword inputtypepasswordsqs-slide-wrapperdata-slide-typecover-page3
2s easesqs-slide-wrapperdata-slide-typecover-page3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typemap gmnoprint3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-solid3
data-slice-typebuttons ulstacked3
p asqs-slide-wrapperdata-slide-typecover-page3
data-slice-typesocial-icons use-maskfilltransparentsqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto data-slice-typebuttons3
data-slice-typesocial-icons svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typecover-page3
audio-player-icons-style-regular data-slice-typealbum3
data-slice-typealbum track-title3
form-wrapper inputtypesubmithoversqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-custom-form ahoversqs-slide-wrapperdata-slide-typecover-page3
data-slice-typebuttons ahoversqs-slide-wrapperdata-slide-typecover-page3
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto data-slice-typebuttons3
p ahoversqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline data-slice-typebuttons3
data-slice-typealbum sqs-slice-album-playlistdemo-album3
data-slice-typealbum sqs-slice-album-playliststacked3
countdown-contentdata-formattextual countdown-unit3
only screen3
sqs-slide-wrapperdata-slide-typecover-page data-slice-typecountdown3
data-slice-typemap gm-style-cc3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-knockout3
sqs-slide-wrapperdata-slide-typecover-page responsive-wrappernotstacked3
data-slice-typesocial-icons440
data-slice-typesocial-iconshover364
social-icons-color-standardsocial-icons-style-solid264
social-icons-color-standardsocial-icons-style-border176
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page137
social-icons-color-standardsocial-icons-style-knockout132
social-icons-color-standardsocial-icons-style-regular132
data-slice-typealbum109
170ms90
data-slice-typebuttons63
data-compound-typepopup-overlay-action60
sqs-slide-containerdata-slide-typepopup-overlay55
icon-wrappersqs-slide-wrapperdata-slide-typecover-page46
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page44
2s41
asqs-slide-wrapperdata-slide-typecover-page39
data-slice-typecountdown35
importantsqs-slide-wrapperdata-slide-typecover-page35
data-slice-typegallery33
responsive-wrapperstacked31
data-slice-typelock30
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline29
data-slice-typepassword29
form-wrapper28
sqs-album-minimal27
ul26
sqs-modal-lightbox-content25
1s25
0sqs-slide-wrapperdata-slide-typecover-page25
sqs-slice-custom-form25
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page24
icon-wrapper23
lightbox-inner22
li21
data-slice-typenavigation21
sqs-slide-wrapperdata-slide-typecover-page20
socialstacked20
socialstackedtext-align-left20
020
lightbox-content19
button-style-outline19
data-slice-typebody19
all18
countdown-contentdata-formatnumeric18
ease-in-outsqs-slide-wrapperdata-slide-typecover-page17
sqs-slice-album-playlist17
tracks16
border-color15
ease-in-out15
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled15
gallery-video-background14
sqs-modal-lightbox-open14
p13
ahoversqs-slide-wrapperdata-slide-typecover-page13
actionsnotstacked12
social-icons-style-solid12
0px12
lisqs-slide-wrapperdata-slide-typecover-page12
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page12
icon-wrapperhover12
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page12
data-slice-typetwitter11
password-style-rectangle11
actionsstacked11
password-style-underlined11
countdown-contentdata-formattextual11
sqs-slice-play-buttonicon-wrappersqs-slide-wrapperdata-slide-typecover-page10
solid10
0ms10
squarespace10
110
icon-wrapperlast-childsqs-slide-wrapperdata-slide-typecover-page10
data-slice-typetwitternotdata-compound-type10
icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typecover-page10
stumbleupon9
vevo9
yelp9
facebook9
email9
vsco9
rdio9
vine9
dropbox9
reddit9
dribbble9
vimeo9
twitter9
fivehundredpix9
twitch9
rss9
tumblr9
tidal9
thedots9
codepen9
smugmug9
behance9
stitcher9
snapchat9
bandsintown9
spotify9
applepodcast9
youtube9
pinterest9
soundcloud9
foursquare9
goodreads9
github9
max-width600pxsqs-slide-wrapperdata-slide-typecover-page9
instagram9
googleplay9
imdb9
linkedin9
itunes9
medium9
meetup9
ease-in-out-moz-transitionbackground-color9
ease-in-out-ms-transitionbackground-color9
ease-in-out-o-transitionbackground-color9
ease-in-outtransitionbackground-color9
flickr9
houzz9
google9
data-slice-typealbumhover8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline8
ulsqs-slide-wrapperdata-slide-typecover-page8
sqs-slice-play-buttonicon-wrapper8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-center8
track7
social-icons-style-border7
show-track-title7
input-wrappernothidden7
video-icon-style-border7
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page7
data-slice-typemap7
spansqs-slide-wrapperdata-slide-typecover-page7
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked7
use-backgroundfillfffsqs-slide-wrapperdata-slide-typecover-page7
alignment-right7
inputtypetextsqs-slide-wrapperdata-slide-typecover-page7
use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typecover-page7
button-style-outlinesqs-modal-lightbox7
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-left6
alignment-center6
2em6
sqs-slice-play-buttonicon-wrapperhover6
10px6
track-progress-bar6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline6
social-icons-style-regular6
button-style-raised6
ulstacked6
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle6
input-wrapper6
audio-player-icons-style-border6
audio-player-icons-style-solid6
snapchathover5
mediumhover5
sqs-slide-layer-content5
meetuphover5
youtubehover5
ease-outopacity5
lock-style-regular5
linkedinhover5
no-vh5
ituneshover5
100ms5
instagramhover5
social-icons-style-knockout5
imdbhover5
yelphover5
vinehover5
pinteresthover5
thedotshover5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined5
soundcloudhover5
spotifyhover5
squarespacehover5
smugmughover5
stitcherhover5
use-maskfilltransparentsqs-slide-wrapperdata-slide-typecover-page5
rsshover5
stumbleuponhover5
tidalhover5
vscohover5
tumblrhover5
twitchhover5
twitterhover5
vevohover5
vimeohover5
reddithover5
buttonsqs-slide-wrapperdata-slide-typecover-page5
rdiohover5
01s5
houzzhover5
foursquarehover5
googlehover5
facebookhover5
button-shape-pill5
button-shape-rounded-corners5
gmnoprint5
applepodcasthover5
gm-style-cc5
bandsintownhover5
sqs-slice-album-playlistplaying5
behancehover5
codepenhover5
dribbblehover5
6px5
dropboxhover5
emailhover5
tweet-timestamp5
data-slice-typebodysqs-slide-wrapperdata-slide-typecover-page5
fivehundredpixhover5
audio-player-icons-style-regular5
googleplayhover5
goodreadshover5
githubhover5
svgsocial-webkit-transitionbackground-color5
flickrhover5
inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typecover-page4
max-width1020pxsqs-slide-wrapperdata-slide-typecover-page4
max-width1020px4
4px4
map-style-minimal-dark4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-raised4
displaytablesqs-slide-wrapperdata-slide-typecover-page4
icon-wrapperwidth24pxheight24pxmargin04
video-icon-style-regular4
neuearialsans-seriffont-weightnormalfont-stylenormalletter-spacing6pxsqs-slide-wrapperdata-slide-typecover-page4
form-itemsqs-slide-wrapperdata-slide-typecover-page4
lock-style-border4
tweet-body4
track-title4
use-iconfilltransparentsqs-slide-wrapperdata-slide-typecover-page4
audio-player-icons-style-knockout4
inputtypepassword-moz-placeholdercolorfffsqs-slide-wrapperdata-slide-typecover-page4
5px4
video-icon-style-solid4
derry4
social-icons-size-largesocial-icons-style-solid3
use-iconfille0393esqs-slide-wrapperdata-slide-typecover-page3
use-iconfillec4652sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill4183c4sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillf94877sqs-slide-wrapperdata-slide-typecover-page3
icon-wrapperdiv-webkit-transformscale2-moz-transformscale2-ms-transformscale2transformscale2sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill0976b4sqs-slide-wrapperdata-slide-typecover-page3
lock-style-solid3
use-iconfill0063dcsqs-slide-wrapperdata-slide-typecover-page3
lock-style-knockout3
use-iconfill00ab6csqs-slide-wrapperdata-slide-typecover-page3
use-iconfill0099e5sqs-slide-wrapperdata-slide-typecover-page3
3px3
video-icon-style-knockout3
icon-wrapperwidth28pxheight28pxmargin03
use-iconfill3b5998sqs-slide-wrapperdata-slide-typecover-page3
captcha-container-wrapper3
use-iconfillcc2127sqs-slide-wrapperdata-slide-typecover-page3
icon-wrapperwidth32pxheight32pxmargin03
use-iconfill006ed2sqs-slide-wrapperdata-slide-typecover-page3
icon-wrapperwidth36pxheight36pxmargin03
use-iconfill007ee5sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillfffbackground-colorfffsqs-slide-wrapperdata-slide-typecover-page3
use-iconfillff4500sqs-slide-wrapperdata-slide-typecover-page3
7px3
use-iconfillea4c89sqs-slide-wrapperdata-slide-typecover-page3
svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typecover-page3
use-iconfillba923bsqs-slide-wrapperdata-slide-typecover-page3
button-play-pause3
use-iconfill1769ffsqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaybutton-style-outline3
gallery-video-backgroundmobile3
inputtypesubmithoversqs-slide-wrapperdata-slide-typecover-page3
sqs-slidesqs-slide-animation-ready3
use-iconfilldc4e41sqs-slide-wrapperdata-slide-typecover-page3
enable-page-bordersqs-slide-container3
responsive-wrapper3
sqs-slicedata-content-emptytruedisplaynonesqs-slide-wrapperdata-slide-typecover-page3
responsive-wrappernotstacked3
use-iconfille6b91esqs-slide-wrapperdata-slide-typecover-page3
adisplayblocksqs-slide-wrapperdata-slide-typecover-page3
responsive-wrapperstackedtext-align-center3
sqs-slide-containerdata-slide-typepopup-overlayenable-overlay-content-border3
actionssqs-slide-wrapperdata-slide-typecover-page3
autoflex13
autosqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlayoverlay-load-animation-slide-in3
use-iconfill5adfcbsqs-slide-wrapperdata-slide-typecover-page3
ease-intransitionopacity3
60px3
use-iconfille4405fsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typebuttonssqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-custom-formsqs-slide-wrapperdata-slide-typecover-page3
error-messagesqs-slide-wrapperdata-slide-typecover-page3
data-compound-typelogo3
data-slice-typegallerysqs-gallery-grid3
use-iconfill382110sqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containernotauto-image-background-color3
ease-in-moz-transitionopacity3
ease-in-ms-transitionopacity3
5emfont14px3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em3
ease-in-o-transitionopacity3
sqs-slice-album-playlistdemo-album3
sqs-slice-album-playliststacked3
use-iconfill1ea9e1sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-extra-smallsocial-icons-style-border3
easesqs-slide-wrapperdata-slide-typecover-page3
arrow-icon3
use-iconfill00b488sqs-slide-wrapperdata-slide-typecover-page3
14px3
social-icons-size-extra-smallsocial-icons-style-regular3
use-iconfill1ab7easqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-smallsocial-icons-style-regular3
social-icons-size-mediumsocial-icons-style-regular3
use-iconfillff0031sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-largesocial-icons-style-regular3
8px3
use-iconfill55aceesqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-extra-largesocial-icons-style-regular3
use-iconfill6441a5sqs-slide-wrapperdata-slide-typecover-page3
inputtypepasswordsqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-extra-smallsocial-icons-style-knockout3
social-icons-size-extra-smallsocial-icons-style-solid3
use-iconfill35465dsqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-smallsocial-icons-style-border3
social-icons-size-smallsocial-icons-style-knockout3
social-icons-size-smallsocial-icons-style-solid3
social-icons-size-mediumsocial-icons-style-border3
use-iconfill8c8070sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-mediumsocial-icons-style-knockout3
social-icons-size-mediumsocial-icons-style-solid3
use-iconfilleb4924sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-largesocial-icons-style-border3
social-icons-size-largesocial-icons-style-knockout3
use-iconfillae995asqs-slide-wrapperdata-slide-typecover-page3
avisitedsqs-slide-wrapperdata-slide-typecover-page3
button-style-solid3
use-iconfillf60sqs-slide-wrapperdata-slide-typecover-page3
only3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline3
screen3
ease-in-outtransitioncolor3
ease-in-out-o-transitioncolor3
ease-in-out-ms-transitioncolor3
ease-in-out-moz-transitioncolor3
use-iconfill7dbb00sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill00b4b3sqs-slide-wrapperdata-slide-typecover-page3
countdown-unit3
use-iconfill000sqs-slide-wrapperdata-slide-typecover-page3
icon-wrapperborder2px3
use-iconfillc41200sqs-slide-wrapperdata-slide-typecover-page3
disclaimer-containersqs-slide-wrapperdata-slide-typecover-page3
buttontypesubmitsqs-slide-wrapperdata-slide-typecover-page3
1px3
social-icons-size-extra-largesocial-icons-style-solid3
data-slice-typeheadingnotdata-compound-type3
use-iconfill7ac143sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill84bd00sqs-slide-wrapperdata-slide-typecover-page3
sqs-modal-lightbox3
social-icons-size-extra-largesocial-icons-style-knockout3
tweet-avatar3
tweet-display-name3
use-iconfille52d27sqs-slide-wrapperdata-slide-typecover-page3
tweet-handle3
social-icons-size-extra-largesocial-icons-style-border3
sqs-slide-layersplit-fifty3

Who hosts Derrymuseum.org?

Derrymuseum.org Hosting Provider Information

Hosted IP Address:64.98.145.30
Hosted Hostname:url.hover.com
Service Provider:Tucows.com Co.
Hosted Country:CanadaCA
Location Latitude:43.6319
Location Longitude:-79.3716
Webserver Software:Squarespace

Is "Tucows.com Co." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
Tucows.com Co.
0.2778%

HTTP Header Analysis for Derrymuseum.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
date: Sat, 24 Oct 2020 00:58:28 GMT
expires: Thu, 01 Jan 1970 00:00:00 GMT
x-content-type-options: nosniff
content-type: text/html;charset=utf-8
content-encoding: gzip
etag: W/"dba5f7c0fa7f2e8314c241210243efdb"
content-length: 31061
Vary: Accept-Encoding
Age: 9320
Accept-Ranges: bytes
x-contextid: 4FnA7p5k/Qpd6YeSd
server: Squarespace

Derrymuseum.org Domain Nameserver Information

HostIP AddressCountry
ns1.hover.com 216.40.47.26
ns2.hover.com 64.98.148.13


Need to find out who hosts Derrymuseum.org?


Domain Registration (WhoIs) information for Derrymuseum.org

 Domain Name: DERRYMUSEUM.ORG
Registry Domain ID: D402200000007344401-LROR
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucows.com
Updated Date: 2020-08-26T10:24:02Z
Creation Date: 2018-08-27T01:53:57Z
Registry Expiry Date: 2021-08-27T01:53:57Z
Registrar Registration Expiration Date:
Registrar: Tucows Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4165350123
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Contact Privacy Inc. Customer 0152513438
Registrant State/Province: ON
Registrant Country: CA
Name Server: NS1.HOVER.COM
Name Server: NS2.HOVER.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-10-24T03:32:49Z

Websites with Similar Names

Derry-nh-realestate.com
Derry NH Real Estate | Homes for sale in Derry New Hampshire
Derry.news
Derry.news
Derryair.eu
Zero Waste North West | Moving the North West towards Zero Waste
Derryanddavid.com
Home - Derry and David Cullwick
Derryanderrough.com
Derryan Derrough – wrestling my thoughts
Derryandraphoe.org
Derry & Raphoe – Website for the Diocese of Derry and Raphoe
Derryanimalhospital.com
Derry Animal Hospital
Derryareaartists.com
The Art of Ingeborg V. Seaboyer - Home

Recently Updated Websites

Zvpartners.com (1 second ago.)Foreverbrain.coach (3 seconds ago.)Mjworks.club (4 seconds ago.)Zivapparels.com (4 seconds ago.)Vivermelhorcomendobem.com (7 seconds ago.)Yap-academy.com (7 seconds ago.)Zenhauseats.com (7 seconds ago.)Virtualhub.biz (9 seconds ago.)Cancelledstampmillennial.blog (9 seconds ago.)Ffmc.fr (12 seconds ago.)Marcoscarvalho.art (13 seconds ago.)Tigercats-golf.club (15 seconds ago.)Natachabouchart2020.biz (15 seconds ago.)Betck.biz (15 seconds ago.)Xtj08.com (16 seconds ago.)Collectorcoins.club (16 seconds ago.)Zarlasht.com (17 seconds ago.)Michaelmarlborough.biz (20 seconds ago.)Thezengolfclub.com (22 seconds ago.)Ysrlyy.com (23 seconds ago.)Betcheckaffiliate.biz (23 seconds ago.)Luckywgrwd.best (25 seconds ago.)Planmydate.app (25 seconds ago.)Zhibaoren.com (28 seconds ago.)Art-universalis.art (29 seconds ago.)Www96ndk.com (34 seconds ago.)Mystech.app (34 seconds ago.)Listo-paye.app (36 seconds ago.)Igameonline90.club (36 seconds ago.)Orvmnmew.biz (38 seconds ago.)

Recently Searched Keywords

免费发布供求信息 (1 second ago.)东莞市琪华包装制品有限公司(张经理) (1 second ago.)单机游戏中心,游戏大全,网页游戏 (6 seconds ago.)管理软件云平台 (7 seconds ago.)香椿种子 (8 seconds ago.)helveticaneuew10-45ligh (10 seconds ago.)常德果园苗圃拆迁评估1养殖场拆迁评估公司1猕猴桃种植评估1 (10 seconds ago.)德州翔实除草布,生产聚丙烯防草布 (10 seconds ago.)金属粉末 (12 seconds ago.)yenileme (22 (15 seconds ago.)tapu kadastro personel alımı (15 seconds ago.)tapu ve kadastro genel müdürlüğü personel alacak - milliyet (15 seconds ago.)muktezelar (17 seconds ago.)tapu kadastro bursa (18 seconds ago.)youtube premium apk indir apkpure (21 seconds ago.)tapu kadastro randevu (26 seconds ago.)talebe bağlı işlemler (27 seconds ago.)tapu kadastro konya (27 seconds ago.)blogs (27 seconds ago.)adana sosyal tesisleri (28 seconds ago.)etselearning (30 seconds ago.)istanbul sosyal tesisleri (31 seconds ago.)imar parsellerinde düzeltme (32 seconds ago.)tapu kadastro parsel sorgulama (33 seconds ago.)tapu-kadastro (35 seconds ago.)the jopera visual composition language (37 seconds ago.)tapu harcında tüm zamanların yıllık rekoru 9 ayda kırıldı - anadolu agency (37 seconds ago.)车辆常见故障巧排除 (37 seconds ago.)tapu kadastro taban puanları (38 seconds ago.)popover2331251704popoverdata-placementtooltip2420408157popoveranimation-exittooltip2420408157popoveranimation-exit-activeopacity0transitiontransform (38 seconds ago.)