Designtube.org  |  Designtube - Creative Design Content
Low trust score  | 
Creative handcrafted, mousemade design content like vector patterns, icons, photoshop brushes, fonts and more.

Designtube.org Website Information

Designtube.org has a Low Trust Score, a Statvoo Rank of F, an Alexa Rank of 217,357, a Majestic Rank of 0, a Domain Authority of 16% and is not listed in DMOZ.

Designtube.org is hosted by Hostwinds LLC. in Oklahoma, Tulsa, United States, 74103.
Designtube.org has an IP Address of 108.174.199.33 and a hostname of client-108-174-199-33.hostwindsdns.com and runs nginx/1.0.10 web server.

The domain designtube.org was registered 4 years 8 months 1 week ago by , it was last modified 201 decades 8 years 9 months ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for designtube.org

Full Whois Lookup for Designtube.org Whois Lookup

Domain Name: DESIGNTUBE.ORG
Registry Domain ID: D171094290-LROR
Registrar WHOIS Server:
Registrar URL: www.namesilo.com
Updated Date: 2017-04-05T19:35:08Z
Creation Date: 2014-02-11T12:02:09Z
Registry Expiry Date: 2018-02-11T12:02:09Z
Registrar Registration Expiration Date:
Registrar: Namesilo, LLC
Registrar IANA ID: 1479
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C163307528-LROR
Registrant Name: Domain Administrator
Registrant Organization: See PrivacyGuardian.org
Registrant Street: 1928 E. Highland Ave. Ste F104
Registrant Street: PMB# 255
Registrant City: Phoenix
Registrant State/Province: AZ
Registrant Postal Code: 85016
Registrant Country: US
Registrant Phone: +1.3478717726
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C163307528-LROR
Admin Name: Domain Administrator
Admin Organization: See PrivacyGuardian.org
Admin Street: 1928 E. Highland Ave. Ste F104
Admin Street: PMB# 255
Admin City: Phoenix
Admin State/Province: AZ
Admin Postal Code: 85016
Admin Country: US
Admin Phone: +1.3478717726
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C163307528-LROR
Tech Name: Domain Administrator
Tech Organization: See PrivacyGuardian.org
Tech Street: 1928 E. Highland Ave. Ste F104
Tech Street: PMB# 255
Tech City: Phoenix
Tech State/Province: AZ
Tech Postal Code: 85016
Tech Country: US
Tech Phone: +1.3478717726
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: DAN.NS.CLOUDFLARE.COM
Name Server: LISA.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-09-01T12:12:38Z

Who hosts Designtube.org?

Designtube.org Web Server Information

Hosted IP Address:108.174.199.33
Hosted Hostname:client-108-174-199-33.hostwindsdns.com
Service Provider:Hostwinds LLC.
Hosted Country:United StatesUS
Location Latitude:36.1563
Location Longitude:-95.9937
Webserver Software:nginx/1.0.10

HTTP Header Analysis for Designtube.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.0.10
Date: Tue, 30 Jun 2015 09:50:02 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/5.2.17p1
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Encoding: gzip


Need to find out who hosts Designtube.org?

Designtube.org Free SEO Report

Website Inpage Analysis for Designtube.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Designtube.org

arabicgold1backgroundhello summersetbuyphotographer2gold vintageillustrations creativemarketiconsvintage luminous lanternshalliebusiness executive coachpage resumereadtemplatestock graphic illustrationsexecutivevarramadan kareemluminousillustrationgreeting cardhelptimelineyesterday 2256filecardcategory templateramadan greeting cardgreetinghallie feminineeditablecoach flyercomments 0facebook coverframestockcommentscategorykareemcoachcategory stock75mecalligraphyfeminine wordpresscreativemarketsiteherbstemplates0youflyersramadanstock graphicpsdclassicarabic calligraphynowread more yesterdayherbs for cookingcookinggold vintage luminousmore yesterday 2256filescovermonth ramadanbullcategory stock graphiccvfacebookgraphicflyerpagebusiness executive2256 bull comments42256 bullyoursummerarabic calligraphy ramadanphotographer facebook coverbuy nowlanternsvintage luminous3vintagemonthcustomizegraphic illustrations creativemarketpatternramadan greetinggraphic illustrationsyesterdaycolorsdrawnisolateddownloadresumewatercolorread moreserifhellocreativeusedexecutive coach flyerthemefemininewhitecalligraphy ramadanramadan kareem backgroundphotoshopyesterday 2256 bullphotographer facebookvectorusecard with arabicfontbusinessillustrationscolorfacebook timelinemore yesterdaycalligraphy ramadan kareemdesigntextkareem backgroundmore6hallie feminine wordpressmonth ramadan greetingluminous lanternsifexecutive coachbull comments 0wordpressbull comments

Longtail Keyword Density for Designtube.org

KeywordsOccurences
bull comments 010
read more yesterday10
2256 bull comments9
yesterday 2256 bull9
more yesterday 22569
card with arabic5
ramadan greeting card5
category stock graphic5
arabic calligraphy ramadan4
calligraphy ramadan kareem4
vintage luminous lanterns4
herbs for cooking3
executive coach flyer3
month ramadan greeting3
ramadan kareem background3
hallie feminine wordpress3
gold vintage luminous3
photographer facebook cover3
stock graphic illustrations3
graphic illustrations creativemarket3
business executive coach3
read more10
bull comments10
comments 010
more yesterday10
yesterday 22569
2256 bull9
ramadan kareem7
buy now7
arabic calligraphy5
ramadan greeting5
stock graphic5
greeting card5
category stock5
vintage luminous5
executive coach4
calligraphy ramadan4
hello summer4
luminous lanterns4
business executive3
page resume3
month ramadan3
coach flyer3
feminine wordpress3
facebook cover3
gold vintage3
category template3
photographer facebook3
hallie feminine3
graphic illustrations3
kareem background3
facebook timeline3
illustrations creativemarket3
more13
your12
ramadan12
template11
creativemarket11
comments10
010
bull10
read10
yesterday10
category10
background9
resume9
kareem9
19
you9
28
buy7
design7
file7
vintage7
now7
vector7
stock6
arabic6
facebook6
theme6
business6
graphic6
hallie6
help6
greeting5
cover5
luminous5
card5
wordpress5
use5
calligraphy5
editable5
cooking4
illustration4
herbs4
font4
coach4
executive4
download4
flyer4
used4
summer4
month4
classic4
page4
customize4
var4
hello4
set4
templates4
lanterns4
34
colors4
illustrations4
creative3
me3
white3
drawn3
frame3
43
watercolor3
isolated3
files3
photographer3
53
text3
gold3
photoshop3
timeline3
63
serif3
flyers3
site3
pattern3
icons3
color3
psd3
73
if3
feminine3
cv3

What are the nameservers for designtube.org?

Designtube.org Domain Nameserver Information

HostIP AddressCountry
ns1.dnsowl.com 198.251.84.16United States United States
ns3.dnsowl.com 209.141.39.150United States United States

Designtube.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Designtube.org is a scam?