Desotocountyschools.org  |  Welcome to Desoto CSD ::
Low trust score  | 
Desoto County School District




Desotocountyschools.org Website Information

Website Ranks & Scores for Desotocountyschools.org

Statvoo Rank Statvoo Rank:H
Alexa Rank Alexa Rank:609,252
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:43%
DMOZ DMOZ Listing:No

Whois information for desotocountyschools.org

Full Whois Lookup for Desotocountyschools.org Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Desotocountyschools.org. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: DESOTOCOUNTYSCHOOLS.ORG
Registry Domain ID: D105691692-LROR
Registrar WHOIS Server:
Registrar URL: http://www.godaddy.com
Updated Date: 2017-02-09T13:41:11Z
Creation Date: 2005-02-07T13:41:06Z
Registry Expiry Date: 2018-02-07T13:41:06Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: C73768356-LROR
Registrant Name: Tina Streeter
Registrant Organization:
Registrant Street: 7138 Hampton Drive
Registrant City: Horn Lake
Registrant State/Province: Mississippi
Registrant Postal Code: 38637
Registrant Country: US
Registrant Phone: +1.6624497183
Registrant Phone Ext:
Registrant Fax: +1.6624294189
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C73768359-LROR
Admin Name: Tina Streeter
Admin Organization:
Admin Street: 7138 Hampton Drive
Admin City: Horn Lake
Admin State/Province: Mississippi
Admin Postal Code: 38637
Admin Country: US
Admin Phone: +1.6624295271
Admin Phone Ext:
Admin Fax: +1.6624294189
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C73768358-LROR
Tech Name: Tina Streeter
Tech Organization:
Tech Street: 7138 Hampton Road
Tech City: Horn Lake
Tech State/Province: Mississippi
Tech Postal Code: 38637
Tech Country: US
Tech Phone: +1.6624295271
Tech Phone Ext:
Tech Fax: +1.6624294189
Tech Fax Ext:
Tech Email: Login to show email
Server: NS19.DOMAINCONTROL.COM
Name Server: NS20.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-20T03:58:01Z

Who hosts Desotocountyschools.org?

Desotocountyschools.org is hosted by Hurricane Electric, Inc. in California, Fremont, United States, 94539.
Desotocountyschools.org has an IP Address of 209.51.164.169 and a hostname of samo4.pcmac.org.



Desotocountyschools.org Web Server Information

Hosted IP Address:209.51.164.169
Hosted Hostname:samo4.pcmac.org
Service Provider:Hurricane Electric, Inc.
Hosted Country:United StatesUS
Location Latitude:37.5497
Location Longitude:-121.9621
Webserver Software:Not Applicable

HTTP Header Analysis for Desotocountyschools.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Length: 71198
Content-Type: text/html; Charset=utf-8
Server: Microsoft-IIS/7.5
MicrosoftOfficeWebServer: 5.0_Pub
X-Powered-By: ASP.NET
Date: Sun, 13 Sep 2015 08:47:35 GMT


Need to find out who hosts Desotocountyschools.org?

Desotocountyschools.org Free SEO Report

Website Inpage Analysis for Desotocountyschools.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Desotocountyschools.org

olivedesoto countycormoranthillbussouthavenlinksannouncementslakeregistrationschool districtmsfeedhhsolive branchbranchreportmiddledcsdesoto centralsupportherecenterhelpstopstudentteachercountyhorn lake0twitter feedhavenewcentralemployeestwitterquick201718 schoolschoolyourhighspecialweeklynewselementarylake cormorantdesotonbspschoolsfinddesoto county schoolmorelewisburgtransportationcareerourhigh nbspemployeeboardwebsitedistricthornyouampzone1techinformationcounty school districtmaphernandohireintermediatepolicybus stoponline201718center hilleducationcounty school

Longtail Keyword Density for Desotocountyschools.org

KeywordsOccurences
county school district3
desoto county school3
twitter feed8
desoto county5
horn lake5
olive branch4
high nbsp4
desoto central4
county school3
school district3
2017-18 school3
bus stop3
lake cormorant3
center hill3
elementary19
school18
nbsp17
desoto9
high9
middle9
feed8
twitter8
lake8
amp7
schools7
education6
hernando6
links6
more6
information5
2017-185
new5
county5
central5
horn5
dcs4
website4
employees4
policy4
district4
news4
04
student4
announcements4
southaven4
lewisburg4
hill4
branch4
olive4
board4
report4
tech4
weekly3
teacher3
you3
hire3
have3
help3
here3
hhs3
13
your3
career3
special3
registration3
cormorant3
intermediate3
ms3
our3
center3
online3
transportation3
map3
quick3
employee3
zone3
stop3
find3
bus3
support3

What are the nameservers for desotocountyschools.org?

Desotocountyschools.org Domain Nameserver Information

HostIP AddressCountry
ns19.domaincontrol.com 216.69.185.10United States United States
ns20.domaincontrol.com 173.201.77.10United States United States

Desotocountyschools.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Desotocountyschools.org is a scam?