Detteerbaseball.no

Startside | Norges Softball og Baseball-forbund

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-22
Category: This site has not been categorized yet


Domain summary

Domain label
detteerbaseball
Domain extension
no
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is detteerbaseball.no ranked relative to other sites:

Percentage of visits to detteerbaseball.no from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Detteerbaseball.no registered?
A: Detteerbaseball.no was registered 1 month, 2 weeks, 5 hours, 8 minutes, 29 seconds ago on Thursday, October 22, 2020.
Q: When was the WHOIS for Detteerbaseball.no last updated?
A: The WHOIS entry was last updated 1 month, 2 weeks, 5 hours, 8 minutes, 29 seconds ago on Thursday, October 22, 2020.
Q: What are Detteerbaseball.no's nameservers?
A: DNS for Detteerbaseball.no is provided by the following nameservers:
  • ns01.one.com
  • ns02.one.com
Q: Who is the registrar for the Detteerbaseball.no domain?
A: The domain has been registered at .
Q: What is the traffic rank for Detteerbaseball.no?
A: Detteerbaseball.no has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Detteerbaseball.no each day?
A: Detteerbaseball.no receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Detteerbaseball.no resolve to?
A: Detteerbaseball.no resolves to the IPv4 address 46.30.215.63.
Q: In what country are Detteerbaseball.no servers located in?
A: Detteerbaseball.no has servers located in the Denmark.
Q: What webserver software does Detteerbaseball.no use?
A: Detteerbaseball.no is powered by Apache webserver.
Q: Who hosts Detteerbaseball.no?
A: Detteerbaseball.no is hosted by One.com A/S in Capital Region, Copenhagen, Denmark, 1052.
Q: How much is Detteerbaseball.no worth?
A: Detteerbaseball.no has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Detteerbaseball.no Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Detteerbaseball.no Free SEO Report

Website Inpage Analysis for Detteerbaseball.no

H1 Headings

0 :

H2 Headings

16 :
  1. Get ready to rumble! 👊
  2. Nye fellesidrettslige koronavettregler
  3. Trenerwebinar med Antidoping Norge
  4. Styremøte 20. april 2020
  5. Sesongoppdatering
  6. Informasjon til klubber vedr. koronavirus
  7. Covid-19: Ekstraordinær støtte til klubber
  8. Styremøte 16. mars 2020
  9. NSBFInternasjonale ambisjoner bygget på sterke lokalmiljøer
  10. Trykk her for påmelding til NSBF-konferansen!
  11. Trykk her for påmelding til Årsavslutningen!
  12. Get ready to rumble! 👊
  13. Nye fellesidrettslige koronavettregler
  14. Trenerwebinar med Antidoping Norge
  15. Våre fire strategiske satsingsområder
  16. Suksessbeskjed

H3 Headings

4 :
  1. Program, lørdag 24. oktober
  2. Program, søndag 25. oktober
  3. Dokumenter
  4. Abonner på nyhetsbrev

H4 Headings

11 :
  1. Barne -og Ungdom
  2. Softball
  3. Baseball
  4. Grenseløse!
  5. Økende!
  6. Ytende!
  7. Ligger til grunn for våre beslutninger og prioriteringer…
  8. Barn og unge
  9. Toppidrett
  10. Softball
  11. Kompetanse

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

43 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

107:
  1. https://www.soft-baseball.no/
    https://www.soft-baseball.no/
  2. Detteerbaseball Jeg er under 13 år
    https://www.soft-baseball.no/prov-softball-og-baseball/jeg-er-under-13-ar/
  3. Detteerbaseball Jeg er 13-19 år
    https://www.soft-baseball.no/prov-softball-og-baseball/jeg-er-13-23-ar/
  4. Detteerbaseball Jeg er voksen
    https://www.soft-baseball.no/prov-softball-og-baseball/jeg-er-over-16-ar/
  5. Detteerbaseball Jeg vil bli trener
    https://www.soft-baseball.no/prov-softball-og-baseball/jeg-vil-bli-trener/
  6. Detteerbaseball Jeg vil bli dommer
    https://www.soft-baseball.no/prov-softball-og-baseball/jeg-vil-bli-dommer/
  7. Detteerbaseball Jeg er lærer eller SFO
    https://www.soft-baseball.no/prov-softball-og-baseball/baseball-i-skolen/
  8. Detteerbaseball Hva er baseball?
    https://www.soft-baseball.no/prov-softball-og-baseball/hva-er-baseball/
  9. Detteerbaseball Klubber i Norge
    https://www.soft-baseball.no/prov-softball-og-baseball/klubber/
  10. Detteerbaseball Jeg vil arrangere teambuilding
    https://www.soft-baseball.no/prov-softball-og-baseball/jeg-vil-arrangere-teambuilding/
  11. Detteerbaseball Nyheter
    https://www.soft-baseball.no/nyheter/
  12. Detteerbaseball Kalender
    https://www.soft-baseball.no/kalendar/
  13. Detteerbaseball 2020 – UTVIKLING
    https://stats.soft-baseball.no/en/events/2020-eliteserien/schedule-and-results
  14. Detteerbaseball 2020
    https://baseballnorge.atlassian.net/wiki/spaces/ESB/pages/684621830/Eliteserien+2020
  15. Detteerbaseball 2019
    https://baseballnorge.atlassian.net/wiki/spaces/ESB/pages/611483887/Eliteserien+2019
  16. Detteerbaseball 2018
    https://baseballnorge.atlassian.net/wiki/spaces/ESB/pages/370409479/Eliteserien+2018
  17. Detteerbaseball 2017
    https://baseballnorge.atlassian.net/wiki/display/ESB/Eliteserien+2017
  18. Detteerbaseball 2020
    https://baseballnorge.atlassian.net/wiki/spaces/FSB/pages/830046280/Forbundsserien+2020
  19. Detteerbaseball 2019
    https://baseballnorge.atlassian.net/wiki/spaces/FSB/pages/611516479/Forbundsserien+2019
  20. Detteerbaseball 2018
    https://baseballnorge.atlassian.net/wiki/spaces/FSB/pages/372211817/Forbundsserien+2018
  21. Detteerbaseball 2017
    https://baseballnorge.atlassian.net/wiki/spaces/FSB/pages/53324187/Forbundsserien+2017+arkivert
  22. Detteerbaseball 2020
    https://baseballnorge.atlassian.net/wiki/spaces/GSS/pages/830373889/Grand+Slam+Softball+2020?moved=true
  23. Detteerbaseball 2020 – NY
    https://stats.soft-baseball.no/en/events/2020-nm-i-baseball/schedule-and-results
  24. Detteerbaseball 2019
    https://baseballnorge.atlassian.net/wiki/spaces/NMV/pages/608665601/NM-Veka+2019
  25. Detteerbaseball 2018
    https://baseballnorge.atlassian.net/wiki/spaces/NMV/pages/508952598/NM-Veka+2018
  26. Detteerbaseball 2020 – NY
    https://stats.soft-baseball.no/en/events/2020-nm-i-softball/schedule-and-results
  27. Detteerbaseball 2019
    https://baseballnorge.atlassian.net/wiki/spaces/NSB/pages/650346497/NM+i+softball+2019
  28. Detteerbaseball Arrangørressurser
    https://www.soft-baseball.no/nyheter-og-artikler/arrangorressurser/
  29. Detteerbaseball Arrangementsmanual
    https://www.soft-baseball.no/nyheter-og-artikler/arrangorressurser/
  30. Detteerbaseball Akademi/Landslag
    https://www.soft-baseball.no/landslag-og-akademi/
  31. Detteerbaseball Tilskuddsordninger
    https://www.soft-baseball.no/offisiell-informasjon/tilskuddsordninger/
  32. Detteerbaseball Søk om skolebesøk o.l.
    https://baseballnorge.typeform.com/to/MRXA8y
  33. Detteerbaseball Refusjoner
    https://www.soft-baseball.no/offisiell-informasjon/refusjoner/
  34. Detteerbaseball Lover, regler og instrukser
    https://www.soft-baseball.no/offisiell-informasjon/lover-og-regler/
  35. Detteerbaseball Antidoping
    https://www.soft-baseball.no/offisiell-informasjon/antidoping/
  36. Detteerbaseball Overgang, lisens og forsikring
    https://www.soft-baseball.no/offisiell-informasjon/lisens-og-forsikring/
  37. Detteerbaseball Personvernerklæring
    https://www.soft-baseball.no/offisiell-informasjon/personvernerklaering/
  38. Detteerbaseball Covid-19 (Korona)
    https://www.soft-baseball.no/regler-og-reningslinjer/informasjon-til-klubber-vedr-koronavirus/
  39. Detteerbaseball Strategiplan
    https://www.soft-baseball.no/strategiplan/
  40. Detteerbaseball Integrering
    https://www.soft-baseball.no/offisiell-informasjon/integrering/
  41. Detteerbaseball Scorekeeping og dømming
    https://www.soft-baseball.no/offisiell-informasjon/domming_scorekeeping/
  42. Detteerbaseball Anlegg
    https://www.soft-baseball.no/offisiell-informasjon/anlegg/
  43. Detteerbaseball Styret og komiteer
    https://www.soft-baseball.no/offisiell-informasjon/kontakter/
  44. Detteerbaseball Møter og referater
    https://www.soft-baseball.no/offisiell-informasjon/moter-og-referater/
  45. Detteerbaseball Hall of Fame
    https://www.soft-baseball.no/offisiell-informasjon/hall-of-fame/
  46. Detteerbaseball Kontakt oss
    https://www.soft-baseball.no/offisiell-informasjon/kontakt/
  47. Detteerbaseball Varsel
    https://www.soft-baseball.no/offisiell-informasjon/varslertjeneste/
  48. Detteerbaseball Get ready to rumble! 👊
    https://www.soft-baseball.no/regler-og-reningslinjer/get-ready-to-rumble-%f0%9f%91%8a/
  49. Detteerbaseball Les Mer
    https://www.soft-baseball.no/regler-og-reningslinjer/get-ready-to-rumble-%f0%9f%91%8a/
  50. Detteerbaseball Nye fellesidrettslige koronavettregler
    https://www.soft-baseball.no/generelt/nye-fellesidrettslige-koronavettregler/
  51. Detteerbaseball Les Mer
    https://www.soft-baseball.no/generelt/nye-fellesidrettslige-koronavettregler/
  52. Detteerbaseball Trenerwebinar med Antidoping Norge
    https://www.soft-baseball.no/trenerutdanning/trenerwebinar-med-antidoping-norge/
  53. Detteerbaseball Les Mer
    https://www.soft-baseball.no/trenerutdanning/trenerwebinar-med-antidoping-norge/
  54. Detteerbaseball Styremøte 20. april 2020
    https://www.soft-baseball.no/styremote/styremote-20-04-2020/
  55. Detteerbaseball Les Mer
    https://www.soft-baseball.no/styremote/styremote-20-04-2020/
  56. Detteerbaseball Sesongoppdatering
    https://www.soft-baseball.no/arrangementer/sesongoppdatering/
  57. Detteerbaseball Les Mer
    https://www.soft-baseball.no/arrangementer/sesongoppdatering/
  58. Detteerbaseball Informasjon til klubber vedr. koronavirus
    https://www.soft-baseball.no/regler-og-reningslinjer/informasjon-til-klubber-vedr-koronavirus/
  59. Detteerbaseball Les Mer
    https://www.soft-baseball.no/regler-og-reningslinjer/informasjon-til-klubber-vedr-koronavirus/
  60. Detteerbaseball Covid-19: Ekstraordinær støtte til klubber
    https://www.soft-baseball.no/generelt/covid-19-ekstraordinaer-stotte-til-klubber/
  61. Detteerbaseball Les Mer
    https://www.soft-baseball.no/generelt/covid-19-ekstraordinaer-stotte-til-klubber/
  62. Detteerbaseball Styremøte 16. mars 2020
    https://www.soft-baseball.no/styremote/styremote-160320/
  63. Detteerbaseball Les Mer
    https://www.soft-baseball.no/styremote/styremote-160320/
  64. Detteerbaseball Liste
    https://www.soft-baseball.no/kalendar/action~agenda/events_limit~3/request_format~json/
  65. Detteerbaseball Dag
    https://www.soft-baseball.no/kalendar/action~oneday/events_limit~3/request_format~json/
  66. Detteerbaseball Måned
    https://www.soft-baseball.no/kalendar/action~month/events_limit~3/request_format~json/
  67. Detteerbaseball Uke
    https://www.soft-baseball.no/kalendar/action~week/events_limit~3/request_format~json/
  68. https://www.soft-baseball.no/kalendar/action~agenda/page_offset~-1/events_limit~3/request_format~json/
    https://www.soft-baseball.no/kalendar/action~agenda/page_offset~-1/events_limit~3/request_format~json/
  69. https://www.soft-baseball.no/kalendar/action~agenda/page_offset~1/events_limit~3/request_format~json/
    https://www.soft-baseball.no/kalendar/action~agenda/page_offset~1/events_limit~3/request_format~json/
  70. Detteerbaseball okt 24 lør
    https://www.soft-baseball.no/kalendar/action~oneday/exact_date~24-10-2020/
  71. Detteerbaseball her
    https://baseballnorge.typeform.com/to/kpH61E
  72. Detteerbaseball her
    https://www.deltager.no/nsbf_arsavslutning_2019
  73. Detteerbaseball Flybusskupong t/r Oslo – Gardermoen 2019
    https://www.soft-baseball.no/flybussen-oslo-rabattkupong-hoteller-gyldig-til-31122019/
  74. Detteerbaseball Les mer
    https://www.soft-baseball.no/aktivitet/nsbf-hostkonferansen-2020/?instance_id=152
  75. Detteerbaseball årsavslutning
    https://www.soft-baseball.no/kalendar/tag_ids~75/
  76. Detteerbaseball Høstkonferanse
    https://www.soft-baseball.no/kalendar/tag_ids~73/
  77. Detteerbaseball konferanse
    https://www.soft-baseball.no/kalendar/tag_ids~74/
  78. Detteerbaseball Legg til i Timely Kalender
    http://www.soft-baseball.no/?plugin=all-in-one-event-calendar&controller=ai1ec_exporter_controller&action=export_events
  79. Detteerbaseball Legg til i Google
    https://www.google.com/calendar/render?cid=http%3A%2F%2Fwww.soft-baseball.no%2F%3Fplugin%3Dall-in-one-event-calendar%26controller%3Dai1ec_exporter_controller%26action%3Dexport_events%26no_html%3Dtrue%26%26
  80. Detteerbaseball Legg til i annen kalender
    http://www.soft-baseball.no/?plugin=all-in-one-event-calendar&controller=ai1ec_exporter_controller&action=export_events&no_html=true
  81. Detteerbaseball Export to XML
    http://www.soft-baseball.no/?plugin=all-in-one-event-calendar&controller=ai1ec_exporter_controller&action=export_events&xml=true
  82. https://www.soft-baseball.no/regler-og-reningslinjer/get-ready-to-rumble-%f0%9f%91%8a/
    https://www.soft-baseball.no/regler-og-reningslinjer/get-ready-to-rumble-%f0%9f%91%8a/
  83. Detteerbaseball regler og reningslinjer
    https://www.soft-baseball.no/category/regler-og-reningslinjer/
  84. Detteerbaseball Turnering
    https://www.soft-baseball.no/category/turnering/
  85. Detteerbaseball les mer
    https://www.soft-baseball.no/regler-og-reningslinjer/get-ready-to-rumble-%f0%9f%91%8a/
  86. https://www.soft-baseball.no/generelt/nye-fellesidrettslige-koronavettregler/
    https://www.soft-baseball.no/generelt/nye-fellesidrettslige-koronavettregler/
  87. Detteerbaseball Generelt
    https://www.soft-baseball.no/category/generelt/
  88. Detteerbaseball les mer
    https://www.soft-baseball.no/generelt/nye-fellesidrettslige-koronavettregler/
  89. https://www.soft-baseball.no/trenerutdanning/trenerwebinar-med-antidoping-norge/
    https://www.soft-baseball.no/trenerutdanning/trenerwebinar-med-antidoping-norge/
  90. Detteerbaseball Trenerutdanning
    https://www.soft-baseball.no/category/trenerutdanning/
  91. Detteerbaseball les mer
    https://www.soft-baseball.no/trenerutdanning/trenerwebinar-med-antidoping-norge/
  92. https://www.idrettsforbundet.no
    https://www.idrettsforbundet.no
  93. http://www.wbsc.org
    http://www.wbsc.org
  94. http://www.baseballeurope.com/
    http://www.baseballeurope.com/
  95. https://www.europeansoftball.org
    https://www.europeansoftball.org
  96. https://antidoping.no
    https://antidoping.no
  97. https://www.nordicchoicehotels.no/nsogbf/
    https://www.nordicchoicehotels.no/nsogbf/
  98. https://www.macronstore.no/
    https://www.macronstore.no/
  99. Detteerbaseball Følg
    https://www.facebook.com/SoftOgBaseball/
  100. Detteerbaseball Følg
    https://twitter.com/baseballnorway
  101. Detteerbaseball Følg
    https://www.instagram.com/baseballnorway/
  102. https://www.soft-baseball.no
    https://www.soft-baseball.no
  103. Detteerbaseball 2020
    https://baseballnorge.atlassian.net/wiki/spaces/GSS/pages/830373889/Grand+Slam+Softball+2020
  104. Detteerbaseball 2020
    https://baseballnorge.atlassian.net/wiki/spaces/NMV/pages/819625985/NM+2020
  105. Detteerbaseball Offisiell Informasjon
    https://www.soft-baseball.no/offisiell-informasjon/
  106. Detteerbaseball Søk om Skolebesøk
    https://baseballnorge.typeform.com/to/MRXA8y
  107. Detteerbaseball Lisens og forsikring
    https://www.soft-baseball.no/offisiell-informasjon/lisens-og-forsikring/

Links - Outbound (nofollow)

0:

Keyword Cloud for Detteerbaseball.no

vrelineheight20px homepagecarousel etpbslidervil bli2019 2018media onlyfontweight 300utoveretpbslider etpbslidedescription maxwidthetpbslider etpbcontainergytitleslideretpbslider titleslideretpbslider etpbslideflereleftalletpbslide maxheightwidthogvioktmedia only screenetpbslidecontenthomepagecarousel etpbslider etpbslidelrdagtidligere8skalhomepagecarousel etpbsliderstttesoftball og baseballblurbtabs tabtitleactivetabsom harnye fellesidrettslige koronavettreglerimportant mediatitleslideretpbsliderimportant media onlybidratab10oslodet erblurbtabs etpbblurbhoverhavrblimeretpbtextoverlaywrapper paddingsoftball2anlegg15px 15px6oktoberunderdette16px5renemaxwidthbaseball og softballrefusjonerennall 3saktiveiconfhvorimportant homepagecarousel etpbsliderfometpbcontaineridrettereaseimportant titleslideretpbslider titleslideretpbsliderblurbtabs etpbblurb1emtabtitleactivetabballenskal vremarginbottomles meretpbtextoverlaywrapperretningslinjertitleslideretpbslider etpbslide maxheightetpbslidecontent p fontsizereglerbanenstyle blurbtabsidretter skaleaseinoutmldetease 8shomepagecarousel etpbslider etpbcontainerog ungeimportant homepagecarouseletpbcontainer heightetpbslider homepagecarousel etpbslidermaxheightgrenselsespanfokusfontweightetpbslideetpbslider etpbcontainer heightetpbslider etpbslide maxheightherharantidoping norgepadding 0p fontsize220pxcenterblurbbarn og ungetitleslideretpbslider titleslideretpbslidervre idretter skalotransition allungdommediakalenderetpbslider etpbslidebarn ogetpbblurbdescriptionetpbsliderwithtextoverlay etpbtextoverlaywrapperfellesidrettsligeotransitionstyledekkettrengerklubbersterketitleslideretpbslider titleslideretpbslider etpbcontainer3s easeinoututviklingduhver12barntildisplay blocktabtitle width15px homepagecarouselbaseball ogfontsize 16pxdisplaytitleslideretpbslider etpbcontainerheightkoronavettreglerscreenhomepagecarousel etpbslider etpbslidecontentlegg tilmp dettabtitledenblurbtabs tabtitle widthetpbsliderwithtextoverlayetpbnewsletterdescriptionetpbslider etpbslidecontentparkeringtransitionblurbtabsellerall easedlslimoptin21important titleslideretpbslideretpbslidetitle fontsizekendeetpbslidetitle spanogsjeg9etpbslidedescription maxwidthetpbslidedescription etpbslidetitleetpbnewsletterfieldytendeformscreen and maxwidthturneringeravonly screennrfellesidrettslige koronavettreglervrtsom skalwidth 100ungensbfwebkittransition alltitleslideretpbslider etpbcontainer height3s20pxhomepagecarousel etpbslider homepagecarouselfontsizemedlemmerinntil8s4lesomergardermoennorgespaddingetterossjeg vil22pxfokus p7400px32pxnskernyedlslimoptin2 etpbnewsletterfieldtransition alletpbslidedescription etpbslidetitle fontsizetextalignetpbslider etpbslidedescription etpbslidetitlenifetpbsliderpitcherenponlyskal bidrafravedall 3s easeinoutnye fellesidrettsligeskal bidra tilsinehomepagecarousel etpbslider etpbslidedescriptionallejeg ervi ertitleslideretpbslider etpbslideetpbblurbhoverbaseballog baseballblurbtabs tabtitle20px homepagecarouselforbundetsoftball ogmanbackground11norge2020 8211etpbslider etpbslidedescriptionvilblockbidra tildlslimoptin2 etpbnewsletterdescriptionregler og13webkittransitionmedetpbslidedescription etpbslidetitle spanetpbblurbnonekasterhomepagecarouselvre idretter15pxetmaiklubbeneall ease 8svil ikkeloveretpbslider homepagecarouselikkemenetpbicon0rene ogspillerlegg3somcolorog softballetpbslidetitleimportantetpbsliderwithtextoverlay etpbtextoverlaywrapper paddingetpbslidecontent pantidopingetpbslidedescriptionkan

Longtail Keyword Density for Detteerbaseball.no

KeywordsOccurences
homepagecarousel etpbslider etpbslidedescription17
media only screen12
etpbslider etpbslidedescription etpbslidetitle11
screen and max-width10
etpbslider homepagecarousel etpbslider8
homepagecarousel etpbslider homepagecarousel8
etpbslidedescription etpbslidetitle font-size7
important homepagecarousel etpbslider6
all ease 8s6
homepagecarousel etpbslider etpbcontainer5
homepagecarousel etpbslider etpbslidecontent4
homepagecarousel etpbslider etpbslide4
etpbslider etpbslide max-height4
nye fellesidrettslige koronavettregler4
barn og unge4
etpbslider etpbcontainer height4
all 3s ease-in-out3
blurb-tabs tab-title width3
etpbsliderwithtextoverlay etpbtextoverlaywrapper padding3
etpbslider etpbslidedescription max-width3
skal bidra til3
important media only3
softball og baseball3
titleslideretpbslider etpbslide max-height3
titleslideretpbslider titleslideretpbslider etpbslide3
important titleslideretpbslider titleslideretpbslider3
titleslideretpbslider etpbcontainer height3
titleslideretpbslider titleslideretpbslider etpbcontainer3
etpbslidecontent p font-size3
etpbslidedescription etpbslidetitle span3
20px homepagecarousel etpbslider3
vre idretter skal3
baseball og softball3
homepagecarousel etpbslider38
etpbslider etpbslidedescription19
les mer15
etpbslidedescription etpbslidetitle12
media only12
only screen12
etpbslider etpbslidecontent8
etpbcontainer height8
etpbslider homepagecarousel8
etpbslide max-height7
etpbslidetitle font-size7
barn og7
blurb-tabs tab-title6
all ease6
ease 8s6
titleslideretpbslider titleslideretpbslider6
det er6
important homepagecarousel6
etpbslider etpbcontainer5
baseball og5
vi er5
legg til5
softball og5
softball- og5
padding 05
nye fellesidrettslige4
blurb-tabs etpbblurbhover4
bidra til4
etpbslider etpbslide4
15px 15px4
blurb-tabs tab-titleactive-tab4
og unge4
antidoping norge4
skal vre4
fellesidrettslige koronavettregler4
width 1004
jeg er4
20px homepagecarousel4
blurb-tabs etpbblurb3
2019 20183
style blurb-tabs3
regler og3
skal bidra3
2020 82113
-o-transition all3
fokus p3
som skal3
og softball3
p det3
vil bli3
jeg vil3
vil ikke3
dl-slim-optin2 etpbnewsletterdescription3
transition all3
etpbslidetitle span3
3s ease-in-out3
idretter skal3
etpbslidecontent p3
p font-size3
font-size 16px3
font-weight 3003
som har3
rene og3
titleslideretpbslider etpbcontainer3
important titleslideretpbslider3
titleslideretpbslider etpbslide3
15px homepagecarousel3
all 3s3
og baseball3
vre idretter3
etpbslidedescription max-width3
etpbsliderwithtextoverlay etpbtextoverlaywrapper3
etpbtextoverlaywrapper padding3
important media3
display block3
tab-title width3
-webkit-transition all3
dl-slim-optin2 etpbnewsletterfield3
og79
etpbslider46
homepagecarousel42
er41
til40
p32
vi27
som26
etpbslidedescription23
vre23
blurb-tabs23
med23
av22
media20
det20
softball20
skal18
mer18
baseball18
max-width16
016
font-size16
important16
les15
dl-slim-optin214
display13
etpbslidetitle13
etpbslidecontent13
113
alle13
har13
screen12
titleslideretpbslider12
nsbf12
padding12
only12
vil12
width11
line-height10
etpbcontainer10
all9
center8
etpbslide8
nye8
tab8
height8
kan8
max-height8
barn8
jeg7
gy7
20px7
15px7
antidoping7
bli7
dette7
klubber7
26
oslo6
eller6
et6
tab-title6
ease6
8s6
den6
oktober6
fra6
oss6
her6
om5
norge5
etter5
mai5
unge5
font-weight5
ikke5
form5
softball-5
aktive5
etpbsliderwithtextoverlay5
35
legg5
ogs5
etpbblurbhover4
icon4
bidra4
norges4
1em4
etpbblurbdescription4
m4
nsker4
ved4
klubbene4
transition4
fokus4
ungdom4
koronavettregler4
fellesidrettslige4
okt4
trenger4
hver4
f4
grenselse4
ytende4
tidligere4
tab-titleactive-tab4
margin-bottom4
text-align4
idretter4
rene4
44
block4
sttte4
turneringer4
retningslinjer4
220px4
etpbtextoverlaywrapper4
left4
utvikling4
fom4
kalender4
sine4
men3
banen3
22px3
53
du3
regler3
ballen3
63
span3
73
lover3
etpbnewsletterdescription3
83
nr3
medlemmer3
kende3
93
flere3
inntil3
gardermoen3
utover3
parkering3
dekket3
forbundet3
lrdag3
kaster3
pitcheren3
16px3
enn3
refusjoner3
-webkit-transition3
3s3
ease-in-out3
-o-transition3
blurb3
color3
style3
etpbblurb3
103
background3
none3
et-pb-icon3
400px3
-og3
spiller3
sterke3
32px3
under3
ha3
hvor3
113
anlegg3
123
133
vr3
nif3
ml3
vrt3
man3
etpbnewsletterfield3

Who hosts Detteerbaseball.no?

Detteerbaseball.no Hosting Provider Information

Hosted IP Address:46.30.215.63
Hosted Hostname:webcluster64.webpod5-cph3.one.com
Service Provider:One.com A/S
Hosted Country:DenmarkDK
Location Latitude:55.6786
Location Longitude:12.5589
Webserver Software:Apache

Is "One.com A/S" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
One.com A/S
0.1679%

HTTP Header Analysis for Detteerbaseball.no

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Thu, 22 Oct 2020 21:02:29 GMT
Server: Apache
X-Powered-By: PHP/7.3.23
X-Redirect-By: WordPress
Location: https://www.soft-baseball.no/
Cache-Control: max-age=0
Expires: Thu, 22 Oct 2020 21:02:29 GMT
Vary: Accept-Encoding
Content-Length: 0
Content-Type: text/html; charset=UTF-8
X-Varnish: 811597836
Age: 0
Via: 1.1 varnish (Varnish/6.5)
Connection: keep-alive

Detteerbaseball.no Domain Nameserver Information

HostIP AddressCountry
ns01.one.com 195.206.121.10
ns02.one.com 195.206.121.138


Need to find out who hosts Detteerbaseball.no?


Domain Registration (WhoIs) information for Detteerbaseball.no

 % By looking up information in the domain registration directory
% service, you confirm that you accept the terms and conditions of the
% service:
% https://www.norid.no/en/domeneoppslag/vilkar/
%
% Norid AS holds the copyright to the lookup service, content,
% layout and the underlying collections of information used in the
% service (cf. the Act on Intellectual Property of May 2, 1961, No.
% 2). Any commercial % use of information from the service, including
% targeted marketing, is prohibited. Using information from the domain
% registration directory service in % violation of the terms and
% conditions may result in legal prosecution.
%
% The whois service at port 43 is intended to contribute to resolving
% technical problems where individual domains threaten the
% functionality, security and stability of other domains or the
% internet as an infrastructure. It does not give any information
% about who the holder of a domain is. To find information about a
% domain holder, please visit our website:
% https://www.norid.no/en/domeneoppslag/

Domain Information

NORID Handle...............: DET1235D-NORID
Domain Name................: detteerbaseball.no
Registrar Handle...........: REG812-NORID
Tech-c Handle..............: HO910R-NORID
Name Server Handle.........: NSON12H-NORID
Name Server Handle.........: NSON8H-NORID
DNSSEC.....................: Signed
DS Key Tag 1...........: 31591
Algorithm 1...........: 13
Digest Type 1...........: 2
Digest 1...........: 28e91a6b63ca1d83f7ce82cc4d8593a5e5dcecfb54783d05ab51d49e38adab78
Key Flags 1...........: 257
Key Protocol 1...........: 3
Key Algorithm 1...........: 13
Key Public 1...........: DMk0sEOsYTmiDvtsFpjgU+G/Pr7Q8y0XsbyVFW3C5yAwiLVJDLIx5TEh7Ksyz6aXAydE+R49v3K5p/BOGb09Mw==

Additional information:
Created: 2014-01-09
Last updated: 2020-01-09

Websites with Similar Names

Dette-developpement.org
Plateforme Dette et Développement - Plateforme d'action et d'information sur la dette des pays du Sud
Dette-technique.com
Bravo ! Votre domaine dette-technique.com a bien été créé avec LWS !
Detteandco.com
高频彩平台_高频彩十大平台
Dettecole.com
D'Ette Cole Design | dettecole
Detteerbaseball.no
Startside | Norges Softball og Baseball-forbund
Detteopara.com
Dette Opara
Dettera.com
New American Cuisine and Wine Bar Ambler, PA | Dettera Restaurant

Recently Updated Websites

Dariuszfrancuz.pl (7 minutes 2 seconds ago.)Kontrust.info (7 minutes 6 seconds ago.)Brevardsolar.com (7 minutes 12 seconds ago.)Aomori-akiya.org (7 minutes 18 seconds ago.)Gourbancharlotte.com (7 minutes 20 seconds ago.)Creativeshrimp.com (7 minutes 27 seconds ago.)Hdrinc.com (7 minutes 50 seconds ago.)Dragonbrandtkd.com (7 minutes 52 seconds ago.)Cookcountyil.gov (8 minutes 10 seconds ago.)Ytjzfw.com (8 minutes 12 seconds ago.)Com-www.com (8 minutes 13 seconds ago.)Auxihop.org (8 minutes 14 seconds ago.)Cheekfit.com (8 minutes 16 seconds ago.)Koleksiyonurunleri.com (8 minutes 16 seconds ago.)Entre-admis.com (8 minutes 18 seconds ago.)Macaverdenet.com.br (8 minutes 18 seconds ago.)Customvac.mb.ca (8 minutes 20 seconds ago.)Withoutdres.com (8 minutes 22 seconds ago.)Travisbernardphotos.com (8 minutes 27 seconds ago.)Netmedplus.com (8 minutes 27 seconds ago.)Empowermentlinguistico.com (8 minutes 27 seconds ago.)Techyfam.com (8 minutes 27 seconds ago.)T6cn.com (8 minutes 27 seconds ago.)Landmanninteractive.com (8 minutes 27 seconds ago.)Centr-audit.com (8 minutes 27 seconds ago.)Uniscrap.dk (13 minutes ago.)Equipecharbonneauetfils.com (13 minutes 12 seconds ago.)Mrpity.com (13 minutes 15 seconds ago.)Bellprescot.com (13 minutes 26 seconds ago.)Tubehardsex.com (13 minutes 31 seconds ago.)

Recently Searched Keywords

candy stripe bracelet (1 second ago.)u0438 (1 second ago.)items per (4 seconds ago.)tooltip (4 seconds ago.)ouch boys (6 seconds ago.)pack 5 (11 seconds ago.)produktrundgänge (14 seconds ago.)prospective families (15 seconds ago.)aib web page (16 seconds ago.)8 38 8 (18 seconds ago.)us championship chess 2020 (18 seconds ago.)wholesale clothing (21 seconds ago.)sara qo039shiqlar (22 seconds ago.)r0return (22 seconds ago.)swertres result june 14 2011 (27 seconds ago.)runrig the years we shared chords (28 seconds ago.)had a tension headache for 3 days (30 seconds ago.)gulaal 14th june 2011 part 1 (30 seconds ago.)pkyek 14 june 2011 (32 seconds ago.)playa vista (34 seconds ago.)ffb-id-ppiisj0 ffb-id-ppiisj0beforeffb-id-ppiisj0afterffb-id-ppiisj0hoverffb-id-ppiisj0focusffb-id-ppiisj0 ffb-id-ppiisj0 (35 seconds ago.)sprouts market close to me (35 seconds ago.)selectdata-previewerror style-k1h666txnavcontainerarrow (35 seconds ago.)ironman usa 2021 (36 seconds ago.)current families (40 seconds ago.)june 14 2011 in roman numerals (43 seconds ago.)joveljose (45 seconds ago.)style-k60k2cmvlanguagebuttonlabelstyle-k60k2cmvlanguagebuttonhas-text (56 seconds ago.)nationalbank (59 seconds ago.)surfing cam (1 minute ago.)