Deutsche-vogelstimmen.de  |  Vogelstimmen - hören Sie 208 deutsche Vogelarten.
Low trust score  | 
Hören und sehen viele von Deutschlands Vögeln. Die Webseite funktioniert auch auf Ihrem Handy!




Deutsche-vogelstimmen.de Website Information

Website Ranks & Scores for Deutsche-vogelstimmen.de

Statvoo Rank Statvoo Rank:H
Alexa Rank Alexa Rank:980,410
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:24%
DMOZ DMOZ Listing:No

Whois information for deutsche-vogelstimmen.de

Full Whois Lookup for Deutsche-vogelstimmen.de Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Deutsche-vogelstimmen.de. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: deutsche-vogelstimmen.de
Nserver: ns1.unoeuro.com
Nserver: ns2.unoeuro.com
Nserver: ns3.unoeuro.com
Nserver: ns4.unoeuro.com
Status: connect
Changed: 2017-08-13T09:31:14+02:00

[Tech-C]
Type: PERSON
Name: Hostmaster Funktionen
Organisation: UnoEuro
Address: Danmarksvej 26
PostalCode: 8660
City: Skanderborg
CountryCode: DK
Phone: +45-86515030
Fax: +45-70235567
Email: Login to show email
2012-12-13T15:01:01+01:00

[Zone-C]
Type: PERSON
Name: Hostmaster Funktionen
Organisation: UnoEuro
Address: Danmarksvej 26
PostalCode: 8660
City: Skanderborg
CountryCode: DK
Phone: +45-86515030
Fax: +45-70235567
Email: Login to show email
2012-12-13T15:01:01+01:00

Who hosts Deutsche-vogelstimmen.de?

Deutsche-vogelstimmen.de is hosted by ZITCOM A/S in Capital Region, Copenhagen, Denmark, 1513.
Deutsche-vogelstimmen.de has an IP Address of 94.231.103.100 and a hostname of dnsforward.unoeuro.com and runs Microsoft-IIS/8.5 web server.



Deutsche-vogelstimmen.de Web Server Information

Hosted IP Address:94.231.103.100
Hosted Hostname:dnsforward.unoeuro.com
Service Provider:ZITCOM A/S
Hosted Country:DenmarkDK
Location Latitude:55.6667
Location Longitude:12.5833
Webserver Software:Microsoft-IIS/8.5

HTTP Header Analysis for Deutsche-vogelstimmen.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html
Content-Encoding: gzip
Vary: Accept-Encoding
Server: Microsoft-IIS/8.5
X-Powered-By: ASP.NET
Date: Wed, 02 Sep 2015 09:52:31 GMT
Content-Length: 8650


Need to find out who hosts Deutsche-vogelstimmen.de?

Deutsche-vogelstimmen.de Free SEO Report

Website Inpage Analysis for Deutsche-vogelstimmen.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:pub-4819822401022719
Google Analytics:Not Applicable

Keyword Cloud for Deutsche-vogelstimmen.de

zusie nichtist nichtviele arten habendemweibchensommereinenalleder gleichenmitverschiedenendeswebsiteeinige arteneinvogelstimmenvgeleslernender vogeldurchdiesgesangnochauf diesingennichtdie klngeeinigesodiesebeispielerdiedassdie lngeartgenossenvieleaberoftmnnchenlnge deslangegleichendass diebuchfinkist derdass siebestimmendas liedhabenfitisvon weibchenbestendie lnge desknnenmansie zuwenn sieanderenlangvgel singenalsdas singenfr diearten singenumdes liedesgeschwindigkeitbis zudieseralsoam bestensieartbereitszu lernenwenn einbedeutetmit demarten habenwenneinemspeziesbedeutungliedseinsehrihremschnelleversees istwiederklngeandereliedessind diehaltender vgelwarumdazumderklangihnenlnge des liedesvon demwirdehervariationenvorvogelgesanglagekannunsereamwerdenerkennennaturzu hrenihrervogelgezwitscherausamseldarangrundbevorvogelbisodermorgenbeitimbregleichzeitigmussauf dersichvonvogelartenaufsekundenviele artenzweidie gleicherufeeinerstimmentonhhemittelanlockenistfrwirmehrerepassageneinzelnenfreidie meistenzwird dasgesungenvogel zuverwendetder regelmenschenauch wenndasdie rufeist esihrefeldwichtigvgel zujahrzu erkennensingtandere artenliederzeitvorlageist einimmerartengleicheeinezu singensindkurzemeistenbeginnendennurwaldlngeeinesobdie vgelder lagevgel habenden klangzu bestimmengruppeerstenunterschiedlichelebenauchchorimregelwiepausenes ist nichtwissenhren

Longtail Keyword Density for Deutsche-vogelstimmen.de

KeywordsOccurences
lnge des liedes3
die lnge des3
viele arten haben3
es ist nicht3
die vgel8
das lied8
ist es7
des liedes7
es ist7
der vgel7
dass die6
ist ein6
die meisten6
andere arten5
wenn sie5
das singen5
zu erkennen5
die klnge5
zu hren5
sind die5
der lage5
ist nicht4
arten haben4
mit dem4
am besten4
auf die4
auf der4
zu lernen4
vgel haben4
viele arten4
arten singen4
der regel4
vgel singen3
der gleichen3
einige arten3
bis zu3
von dem3
die lnge3
lnge des3
die gleiche3
die rufe3
vogel zu3
den klang3
sie zu3
der vogel3
auch wenn3
zu singen3
sie nicht3
zu bestimmen3
wenn ein3
von weibchen3
fr die3
dass sie3
ist der3
wird das3
vgel zu3
die96
der82
zu58
ist45
das44
sie39
vgel31
singen30
sind27
es25
ein24
den23
arten23
mit23
von23
dass21
wenn21
werden20
des19
wie18
oder18
lied17
dem17
nicht16
sich16
haben15
eine14
auf14
fr14
klnge13
am13
sehr12
wird12
kann12
vogel12
erkennen11
einem11
andere10
dies10
lieder10
um10
mnnchen10
lernen10
hren10
im9
so9
knnen9
bei9
auch9
liedes8
dieser8
sein8
oft8
viele8
einen8
immer7
ihre7
diese7
gleiche7
anderen7
einige7
beispiel7
klang7
einer7
weibchen7
wald7
meisten7
verwendet7
vogelstimmen6
lnge6
noch6
vogelgesang6
er6
zum6
alle5
eher5
muss5
lage5
singt5
natur5
vogelarten5
bis5
besten5
ihrem5
als5
aus5
timbre5
lange5
gesang5
website5
wieder5
regel5
vorlage5
art5
verschiedenen4
spezies4
zeit4
ihrer4
vor4
rufe4
mittel4
jahr4
gleichen4
bevor4
vogelgezwitscher4
zwei4
grund4
artgenossen4
sekunden4
kurze4
chor4
wir4
buchfink4
wichtig4
gleichzeitig4
ihnen3
sommer3
nur3
leben3
halten3
variationen3
amsel3
ersten3
eines3
gruppe3
frei3
fitis3
lang3
z3
geschwindigkeit3
menschen3
durch3
aber3
tonhhe3
man3
anlocken3
da3
bedeutung3
also3
passagen3
stimmen3
mehrere3
daran3
bereits3
wissen3
pausen3
unsere3
unterschiedliche3
bedeutet3
beginnen3
verse3
feld3
warum3
ob3
bestimmen3
morgen3
gesungen3
einzelnen3
schnelle3

What are the nameservers for deutsche-vogelstimmen.de?

Deutsche-vogelstimmen.de Domain Nameserver Information

HostIP AddressCountry
ns1.unoeuro.com 46.36.215.2Czech Republic Czech Republic
ns2.unoeuro.com 93.191.156.2Denmark Denmark
ns3.unoeuro.com 83.217.78.186Belgium Belgium
ns4.unoeuro.com 85.159.211.233United Kingdom United Kingdom

Deutsche-vogelstimmen.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Deutsche-vogelstimmen.de is a scam?