Dhl.com.hk  |  DHL | Hong Kong | English
Low trust score  | 
DHL is the global market leader in the logistics industry. DHL commits its expertise in international parcel, express, air and ocean freight, road and rail transportation, contract logistics and international mail services to its customers.

Dhl.com.hk Website Information

Dhl.com.hk has a Low Trust Score, a Statvoo Rank of F, an Alexa Rank of 47,021, a Majestic Rank of 216,266, a Domain Authority of 50% and is not listed in DMOZ.

Dhl.com.hk is hosted by DHL Information Services (Europe) s.r.o in Hlavni Mesto Praha, Prague, Czech Republic, 130 00.
Dhl.com.hk has an IP Address of 165.72.192.235 and a hostname of 165.72.192.235.

The domain dhl.com.hk was registered 201 decades 9 years 1 day ago by , it was last modified 201 decades 9 years 1 day ago and currently is set to expire 201 decades 9 years 1 day ago.


Whois information for dhl.com.hk

Full Whois Lookup for Dhl.com.hk Whois Lookup

-------------------------------------------------------------------------------
Whois server by HKIRC
-------------------------------------------------------------------------------
.hk top level Domain names can be registered via HKIRC-Accredited Registrars.
Go to https://www.hkirc.hk/content.jsp?id=280 for details.
-------------------------------------------------------------------------------


Domain Name: DHL.COM.HK

Domain Status: Active

Contract Version: Refer to registrar

Registrar Name: MARKMONITOR INC.

Registrar Contact Information: Email: Login to show email
Contact Information:

Company English Name (It should be the same as the registered/corporation name on your Business Register Certificate or relevant documents): DHL EXPRESS (HONG KONG) LIMITED
Company Chinese name: ??????????????
Address: 11/F., TRADE SQUARE,
681 CHEUNG SHA WAN ROAD, KOWLOON
HONG KONG
Country: HK
Email: Login to show email
Name Commencement Date: 07-01-1998
Expiry Date: 02-04-2018
Re-registration Status: Complete


Administrative Contact Information:

Given name: DOMAIN
Family name: ADMINISTRATOR
Company name: DEUTSCHE POST AG
Address: CHARLES-DE-GAULLE-STRASSE 20 BONN 53113 -
Country: DE
Phone: +49-22818296701
Fax: +49-22818296798
Email: Login to show email
Name: HK3728333T



Technical Contact Information:

Family name: ADMINISTRATOR
Company name: DEUTSCHE POST AG
Address: CHARLES-DE-GAULLE-STRASSE 20 BONN 53113 -
Country: DE
Phone: +49-22818296701
Fax: +49-22818296798
Email: Login to show email
Servers Information:

NS6.DHL.COM
NS4.DHL.COM


Status Information:

Domain Prohibit Status:


-------------------------------------------------------------------------------
The Registry contains ONLY .com.hk, .net.hk, .edu.hk, .org.hk,
.gov.hk, idv.hk. and .hk $domains.
-------------------------------------------------------------------------------

WHOIS Terms of Use
By using this WHOIS search enquiry service you agree to these terms of use.
The data in HKDNR's WHOIS search engine is for information purposes only and HKDNR does not guarantee the accuracy of the data. The data is provided to assist people to obtain information about the registration record of domain names registered by HKDNR. You agree to use the data for lawful purposes only.

You are not authorised to use high-volume, electronic or automated processes to access, query or harvest data from this WHOIS search enquiry service.

You agree that you will not and will not allow anyone else to:

a. use the data for mass unsolicited commercial advertising of any sort via any medium including telephone, email or fax; or

b. enable high volume, automated or electronic processes that apply to HKDNR or its computer systems including the WHOIS search enquiry service; or

c. without the prior written consent of HKDNR compile, repackage, disseminate, disclose to any third party or use the data for a purpose other than obtaining information about a domain name registration record; or

d. use such data to derive an economic benefit for yourself.

HKDNR in its sole discretion may terminate your access to the WHOIS search enquiry service (including, without limitation, blocking your IP address) at any time including, without limitation, for excessive use of the WHOIS search enquiry service.

HKDNR may modify these terms of use at any time by publishing the modified terms of use on its website.

Who hosts Dhl.com.hk?

Dhl.com.hk Web Server Information

Hosted IP Address:165.72.192.235
Hosted Hostname:165.72.192.235
Service Provider:DHL Information Services (Europe) s.r.o
Hosted Country:Czech RepublicCZ
Location Latitude:50.0833
Location Longitude:14.4667
Webserver Software:unknown

HTTP Header Analysis for Dhl.com.hk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Last-Modified: Thu, 18 Jun 2015 17:26:08 GMT
ETag: "320f82-30cbb-518ce1a5a2c00"
Accept-Ranges: bytes
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 24715
Content-Type: text/html; charset=UTF-8
Date: Tue, 23 Jun 2015 05:00:38 GMT
Connection: keep-alive


Need to find out who hosts Dhl.com.hk?

Dhl.com.hk Free SEO Report

Website Inpage Analysis for Dhl.com.hk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Dhl.com.hk

getnewwindow nulltypefinalpiecestrft enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttracknumber track dhlbeneluxidmessage presentfalsevar selectedvalbrandform ifselectedvalfunctiontrackingnumbertracking number iffnftstripinnermsgbnnelxdata fnftstripbnnelxdata1 vardeliverynbsp varfnftupdateuiemptytracks erroremptysuniqueid returnsupplyreturn false trackingfnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrackiffnftstripinnermsgerror message presentinteractiveerroremptysuniqueid return falsefreighthbnxxselectedvalbrand varairfpcdomainnumbersnohelpicon var istaskcenterdocumentgetelementbyidtaskcenteridvalueexpressfashion5track dhlformuniqueidlogisticsinside beneluxtracking javaheight800width900left100top100toolbaryeslocationyesdirectoriesyesstatusyesmenubaryesscrollbarsyescopyhistorynoresizableyes var newwindowdocumentgetelementbyidelementidinnerhtml ifcharactercodetaskcenterwebtrendsvar url httpsdhlidhlcomdhliclientpublictrackingsearchtypehbnsearchvalueenablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttracksel varsector nbspundefinedplease enablemessageinformationchainworkinghttpsdhlidhlcomdhliclientpublictrackingsearchtypecrnsearchvalue iffalse varwindowopenurltrackingfeatures elsedeliverselectedvalsectorclean the errorforwarding0 var flagchain find outdocumentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrackvaluenewwindow windowopenurltrackingfeatures elsehttpsdhlidhlcomdhliclientpublictrackingsearchtypehbnsearchvalue ifnull var hideshipmenttypescreen documentgetelementbyidelementidinnerhtml ifcharactercodeout more nbspselectedval var innermsgcode enterscriptemail scamhttpsdhlidhlcomdhliclientpublictrackingsearchtypehbnsearchvaluefalse ifinnermsg enterretailfeatures height800width900left100top100toolbaryeslocationyesdirectoriesyesstatusyesmenubaryesscrollbarsyescopyhistorynoresizableyesalertinside true varelse if fnshowcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrackfastbnnelxdatanbsp nbspifcharactercode 13 charactercodeifcharactercode 13true dijitbyidmainnewslisttabcontainerteaserrotatorselectchildtabpropidurlvar i 0enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrack documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttracksubmitquerystringresponsibilityfnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrackifbnnelxdatalength0innermsgpresentglobaldocumentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttracksubmitoutdocumentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttracksubmit else returntracking number trackflag true varpasstransportationdocumentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink75ainsideparsysfasttrackvalueurlreplace trackingnumbertrackselectedbrand var selectedvalbrandselectedvalbrand selectedbrandoptionsselectedbrandselectedindexvaluedocumentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttracksubmit elseelse if fnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttracksel var selectedbrandchangesflag2 nohelpicon varurl httpsdhlidhlcomdhliclientpublictrackingsearchtypehbnsearchvalue if3else returninternationalfeaturesselectedval crnxx varselelse return falsetimestart changestracking resultstrue var featuresenablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrackvar urlfeatures height800width900left100top100toolbaryeslocationyesdirectoriesyesstatusyesmenubaryesscrollbarsyescopyhistorynoresizableyes vardeliveriesbrowserquotevar istaskcenterdocumentgetelementbyidtaskcenteridvalue cleancontactwarehousingurl httpsdhlidhlcomdhliclientpublictrackingsearchtypecrnsearchvalueprovide tracking resultscode enter yourfinalpiecestrft enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrack documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttracksubmittrackingnumber newwindow windowopenurltrackingfeaturesfalse startfalse start changesvar innermsg entervar bnnelxdata fnftstripbnnelxdata1chain solutionsseloptionsselselectedindexvalue0iffnftstripinnermsg bnnelxdatatrue var flag2changes to passwindowopenurltrackingfeatures else ifcheckplease enable javaifcharactercodevar selectedvalbrand varfinalpiecestrft enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrack documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttracksubmitifselectedvalhideshipmenttypecriticalnumber tracking code62fnftupdateuiemptytracks erroremptysuniqueidvar newwindow nullmydhlurl if urlsecurityurl urlreplaceurl urlreplace trackingnumberheight800width900left100top100toolbaryeslocationyesdirectoriesyesstatusyesmenubaryesscrollbarsyescopyhistorynoresizableyesfnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrack formdistributionflag2 nohelpiconfnshowcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrackfnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrack form ifselectedvalurl httpsdhlidhlcomdhliclientpublictrackingsearchtypehbnsearchvaluetracking codevar flag trueformuniqueid var bnnelxdata1removeallmatchfindfinalpiecestrftinnermsg enter yourtrackingnumber newwindowpeoplefoundsearchmatch true dijitbyidmainnewslisttabcontainerteaserrotatorselectchildtabpropidhbnxx var urlvar hideshipmenttypereturn false ifselectedval hbnxx varfinalpiecestrft enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrackif selectedval crnxxenable java scriptselectedval varifselectedval dhl documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrackvalueurl urlurlreplace trackingnumber newwindowvar istaskcenterdocumentgetelementbyidtaskcenteridvaluehttpsdhlidhlcomdhliclientpublictrackingsearchtypecrnsearchvalue if urlwarning email scamoffhideshipmenttype false selvar innermsgdocumentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrackvalue finalpiecestrft enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrackyourchangenumberourfnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrack form ifselectedvalformuniqueid varurl iftechnologybnnelxdata ifbnnelxdatalength0 fnftupdateuiemptytracksnohelpicon varflag2var flag2var selobjif fnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrackbenelux checknewwindowdocumentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttracksubmitbnnelxdata fnftstripbnnelxdata1onlinetrue varyour browser selectfnftupdateuiemptytrackscodecharactercode 44find outfind out moreair freightheight800width900left100top100toolbaryeslocationyesdirectoriesyesstatusyesmenubaryesscrollbarsyescopyhistorynoresizableyes varbrowser selectif selectedval hbnxxwindowopenurltrackingfeaturesistaskcenterdocumentgetelementbyidtaskcenteridvalue cleanrequired to providefnftstripbnnelxdata1 varbrandfnftstripbnnelxdata1searchmatchwithvar selectedbrandflagtracking java scriptformtagsselectedval var trackingnumberelse ifselectedbrandselectedval seloptionsselselectedindexvaluetime criticaltaburl httpsdhlidhlcomdhliclientpublictrackingsearchtypecrnsearchvalue ifnumber trackingnullselectedbrandoptionsselectedbrandselectedindexvaluedoscreendocumentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttracksubmit else returnscreen documentgetelementbyidelementidinnerhtmlshipmentimportantjquerydocumentreadyfunctionifbnnelxdatalength0 fnftupdateuiemptytracksnewwindow windowopenurltrackingfeaturesbusinessroadout what wevar selectedbrand varcleanenable javaamptrackingfoundsearchmatch truecrnxx var urlallinsideif url urlselectedvalbrand selectedbrandoptionsselectedbrandselectedindexvalue ifhideshipmenttype falsedocumentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrackvalue finalpiecestrft enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrack13 charactercodedhl expressdhl documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrackvaluebnnelxdata ifbnnelxdatalength0false tracking javasolutionsvar bnnelxdatamore nbspworldbnnelxdata bnnelxdataurlreplaceselectedbrand varvar selectedval varenter yourdhl documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrackvaluedomesticselectedval hbnxxcompanyvar newwindowyour trackingcustomersresults please enablepass brandelsecampaignnameoldvar hideshipmenttype falsehttpsdhlidhlcomdhliclientpublictrackingsearchtypehbnsearchvalue if urlprovideselectedbrandoptionsselectedbrandselectedindexvalue ifvar features height800width900left100top100toolbaryeslocationyesdirectoriesyesstatusyesmenubaryesscrollbarsyescopyhistorynoresizableyeselse if fnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrackworking at dhlbrowser select shipmentskipenablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrack documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttracksubmit elsenewerroremptysuniqueidfinalpiecestrft enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrackvar sel varifbnnelxdatalength0 fnftupdateuiemptytracks erroremptysuniqueidvar url ifjavarailinside benelux checkdhl documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrackvalueif fnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrack formalertinsidetheform removeservicedhl documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrackvalue finalpiecestrftistaskcenterdocumentgetelementbyidtaskcenteridvaluedocumentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttracksubmit else returncountry timejava scriptnumber iffnftstripinnermsghttpsdhlidhlcomdhliclientpublictrackingsearchtypecrnsearchvalue13 charactercode 44if fnshowcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrack formshipiffnftstripinnermsg bnnelxdata bnnelxdatadijitbyidmainnewslisttabcontainerteaserrotatorselectchildtabpropidwordlistbnnelxdata1var selectedvalresultsreturn false startemaildhlfnshowcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrack form ifselectedvalproductsdhl documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrackvalue finalpiecestrftpostaldocumentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrackvalue finalpiecestrftselectscript in yourhbnxx varenablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrackcompetitivefalse trackingifselectedval dhlcrnxx varnumber trackwarningnohelpiconvarreturn falseservicesenabledocumentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrackvalue finalpiecestrftdhl documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrackvalue finalpiecestrftworldwideform ifselectedval dhllinkcontainerleftdocumentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrackvaluevar featuresscript is requiredfinalpiecestrft enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrack documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttracksubmittrack dhl interactiveindustryenter your trackingdhl serviceexpiredayenablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrack documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttracksubmit elsevar flag2 nohelpiconpass brand insidecountryfalse selcustomssupply chain findifprovide trackingenablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrack documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttracksubmit elsenumber iffnftstripinnermsg bnnelxdataecommerceif fnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrackurl url urlreplaceifselectedval dhl documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrackvaluesector nbsp nbspvar flagwe dotracking code enterpleaseyour tracking numberrequiredcountry time criticalchain findtracking numbermore nbsp nbspmorevar trackingnumbershippingbrand inside beneluxstartif selectedvalfnshowcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrack formcharactercodefalse if selectedvalscam1truewarning emailyour browserenterselectedval crnxxalertinside truedocumentgetelementbyidelementidinnerhtml ifcharactercode 13theirnbspshipment typebnnelxdata bnnelxdata ifbnnelxdatalength0aerospacebenelux check selectedbranddocumentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrackvaluewedocumentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrackvalue finalpiecestrft enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrackhelpfnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrack formfoundsearchmatchautomotivedocumentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttracksubmit elseplease selectdhl ecommerce0 varfnftstripbnnelxdata1 var selvar url httpsdhlidhlcomdhliclientpublictrackingsearchtypecrnsearchvaluedocumentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrackvalue finalpiecestrftnull vardocumentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttracksubmitnewwindow null varif fnshowcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrackflag truereturnacrossout moreenablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrack documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttracksubmitselectedvalbrand var selectedvalbrand insideerror messageerrorselect shipmentresults pleasedocumentgetelementbyidelementidinnerhtmldocumentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttracksubmit elseenablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrack documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttracksubmitdhl interactivecookievalcrnxxsupply chain4if fnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrack formerroremptysuniqueid returnvar bnnelxdata1coststracking results pleaseif urlselectedvalbrandifselectedval dhl documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrackvaluetheformcheck selectedbrandselect shipment typesupply chain solutions

Longtail Keyword Density for Dhl.com.hk

KeywordsOccurences
urlreplace trackingnumber newwindow18
url urlreplace trackingnumber18
trackingnumber newwindow windowopenurltrackingfeatures18
form ifselectedval dhl18
newwindow windowopenurltrackingfeatures else18
url url urlreplace18
if url url18
windowopenurltrackingfeatures else if18
else return false18
return false if15
false if selectedval14
find out more10
url if url9
ifselectedval dhl documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrackvalue9
finalpiecestrft enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrack documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttracksubmit9
enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrack documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttracksubmit else9
documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttracksubmit else return9
documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrackvalue finalpiecestrft enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrack9
dhl documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrackvalue finalpiecestrft9
fnshowcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrack form ifselectedval9
var url if9
if fnshowcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrack form9
else if fnshowcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrack9
out what we9
sector nbsp nbsp9
out more nbsp7
more nbsp nbsp7
enter your tracking6
your tracking number6
0 var flag4
documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttracksubmit else return4
enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrack documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttracksubmit else4
var flag true4
var flag2 nohelpicon4
clean the error4
error message present4
screen documentgetelementbyidelementidinnerhtml ifcharactercode4
var istaskcenterdocumentgetelementbyidtaskcenteridvalue clean4
nohelpicon var istaskcenterdocumentgetelementbyidtaskcenteridvalue4
finalpiecestrft enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrack documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttracksubmit4
flag2 nohelpicon var4
flag true var4
dhl documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrackvalue finalpiecestrft4
enable java script4
please enable java4
results please enable4
script in your4
tracking code enter4
else if fnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrack4
if fnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrack form4
tracking results please4
provide tracking results4
documentgetelementbyidelementidinnerhtml ifcharactercode 134
selectedval var trackingnumber4
ifselectedval dhl documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrackvalue4
fnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrack form ifselectedval4
required to provide4
script is required4
documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrackvalue finalpiecestrft enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrack4
true var flag24
var selectedval var4
var hideshipmenttype false4
var selectedvalbrand var4
selectedval var innermsg4
var innermsg enter4
bnnelxdata ifbnnelxdatalength0 fnftupdateuiemptytracks4
bnnelxdata bnnelxdata ifbnnelxdatalength04
iffnftstripinnermsg bnnelxdata bnnelxdata4
selectedbrand var selectedvalbrand4
var selectedbrand var4
formuniqueid var bnnelxdata14
13 charactercode 444
ifcharactercode 13 charactercode4
var bnnelxdata fnftstripbnnelxdata14
bnnelxdata fnftstripbnnelxdata1 var4
sel var selectedbrand4
var sel var4
fnftstripbnnelxdata1 var sel4
ifbnnelxdatalength0 fnftupdateuiemptytracks erroremptysuniqueid4
selectedvalbrand var selectedval4
features height800width900left100top100toolbaryeslocationyesdirectoriesyesstatusyesmenubaryesscrollbarsyescopyhistorynoresizableyes var4
var features height800width900left100top100toolbaryeslocationyesdirectoriesyesstatusyesmenubaryesscrollbarsyescopyhistorynoresizableyes4
true var features4
height800width900left100top100toolbaryeslocationyesdirectoriesyesstatusyesmenubaryesscrollbarsyescopyhistorynoresizableyes var newwindow4
var newwindow null4
null var hideshipmenttype4
fnftupdateuiemptytracks erroremptysuniqueid return4
alertinside true var4
newwindow null var4
changes to pass4
false start changes4
erroremptysuniqueid return false4
pass brand inside4
return false start4
brand inside benelux4
inside benelux check4
var url httpsdhlidhlcomdhli-clientpublictrackingsearchtypecrnsearchvalue3
httpsdhlidhlcomdhli-clientpublictrackingsearchtypecrnsearchvalue if url3
crnxx var url3
url httpsdhlidhlcomdhli-clientpublictrackingsearchtypecrnsearchvalue if3
if selectedval crnxx3
your browser select3
enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrack documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttracksubmit else3
documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttracksubmit else return3
selectedval crnxx var3
code enter your3
number track dhl3
track dhl interactive3
finalpiecestrft enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrack documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttracksubmit3
tracking number track3
warning email scam3
select shipment type3
number tracking code3
browser select shipment3
return false tracking3
country time critical3
tracking java script3
innermsg enter your3
tracking number iffnftstripinnermsg3
number iffnftstripinnermsg bnnelxdata3
false tracking java3
working at dhl3
chain find out3
supply chain solutions3
supply chain find3
var i 03
foundsearchmatch true dijitbyidmainnewslisttabcontainerteaserrotatorselectchildtabpropid3
benelux check selectedbrand3
selectedvalbrand selectedbrandoptionsselectedbrandselectedindexvalue if3
if fnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrack form3
else if fnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrack3
fnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrack form ifselectedval3
ifselectedval dhl documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrackvalue3
dhl documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrackvalue finalpiecestrft3
httpsdhlidhlcomdhli-clientpublictrackingsearchtypehbnsearchvalue if url3
url httpsdhlidhlcomdhli-clientpublictrackingsearchtypehbnsearchvalue if3
if selectedval hbnxx3
hideshipmenttype false sel3
selectedval hbnxx var3
hbnxx var url3
var url httpsdhlidhlcomdhli-clientpublictrackingsearchtypehbnsearchvalue3
documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrackvalue finalpiecestrft enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrack3
return false26
nbsp nbsp20
find out19
url urlreplace18
url url18
var url18
if url18
urlreplace trackingnumber18
newwindow windowopenurltrackingfeatures18
ifselectedval dhl18
else return18
form ifselectedval18
else if18
windowopenurltrackingfeatures else18
trackingnumber newwindow18
if selectedval18
false if15
supply chain11
out more10
dhl documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrackvalue9
documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrackvalue finalpiecestrft9
finalpiecestrft enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrack9
if fnshowcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrack9
url if9
documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttracksubmit else9
fnshowcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrack form9
enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrack documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttracksubmit9
we do9
sector nbsp9
true var8
java script8
selectedval var8
dhl express7
more nbsp7
tracking number6
enter your6
your tracking6
0 var5
your browser4
enable java4
air freight4
documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttracksubmit else4
please enable4
var trackingnumber4
hideshipmenttype false4
height800width900left100top100toolbaryeslocationyesdirectoriesyesstatusyesmenubaryesscrollbarsyescopyhistorynoresizableyes var4
features height800width900left100top100toolbaryeslocationyesdirectoriesyesstatusyesmenubaryesscrollbarsyescopyhistorynoresizableyes4
var newwindow4
newwindow null4
var hideshipmenttype4
enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrack documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttracksubmit4
finalpiecestrft enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrack4
please select4
if fnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrack4
dhl interactive4
var features4
code enter4
dhl documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrackvalue4
provide tracking4
results please4
tracking results4
documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrackvalue finalpiecestrft4
tracking code4
fnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrack form4
null var4
charactercode 444
13 charactercode4
ifcharactercode 134
documentgetelementbyidelementidinnerhtml ifcharactercode4
formuniqueid var4
alertinside true4
var sel4
fnftstripbnnelxdata1 var4
bnnelxdata fnftstripbnnelxdata14
var bnnelxdata4
screen documentgetelementbyidelementidinnerhtml4
message present4
var flag24
flag true4
var flag4
nbsp var4
flag2 nohelpicon4
nohelpicon var4
error message4
istaskcenterdocumentgetelementbyidtaskcenteridvalue clean4
var istaskcenterdocumentgetelementbyidtaskcenteridvalue4
sel var4
var bnnelxdata14
false start4
erroremptysuniqueid return4
fnftupdateuiemptytracks erroremptysuniqueid4
start changes4
var selectedbrand4
benelux check4
inside benelux4
brand inside4
ifbnnelxdatalength0 fnftupdateuiemptytracks4
pass brand4
var selectedval4
selectedvalbrand var4
var selectedvalbrand4
bnnelxdata ifbnnelxdatalength04
var innermsg4
selectedbrand var4
innermsg enter4
bnnelxdata bnnelxdata4
iffnftstripinnermsg bnnelxdata4
url httpsdhlidhlcomdhli-clientpublictrackingsearchtypecrnsearchvalue3
httpsdhlidhlcomdhli-clientpublictrackingsearchtypecrnsearchvalue if3
crnxx var3
selectedval crnxx3
enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrack documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttracksubmit3
documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttracksubmit else3
browser select3
finalpiecestrft enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrack3
shipment type3
documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrackvalue finalpiecestrft3
track dhl3
email scam3
warning email3
number tracking3
number track3
select shipment3
false var3
false tracking3
dhl ecommerce3
tracking java3
country time3
time critical3
chain solutions3
chain find3
true dijitbyidmainnewslisttabcontainerteaserrotatorselectchildtabpropid3
foundsearchmatch true3
dhl service3
theform remove3
number iffnftstripinnermsg3
check selectedbrand3
url httpsdhlidhlcomdhli-clientpublictrackingsearchtypehbnsearchvalue3
httpsdhlidhlcomdhli-clientpublictrackingsearchtypehbnsearchvalue if3
if fnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrack3
fnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrack form3
hbnxx var3
selectedval hbnxx3
selectedvalbrand selectedbrandoptionsselectedbrandselectedindexvalue3
selectedbrandoptionsselectedbrandselectedindexvalue if3
false sel3
selectedval seloptionsselselectedindexvalue3
dhl documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrackvalue3
var112
if75
dhl58
url56
nbsp45
else38
return33
false33
selectedval30
tracking23
newwindow22
trackingnumber22
true21
form20
your20
find20
out19
ifselectedval18
finalpiecestrft18
windowopenurltrackingfeatures18
urlreplace18
express17
services17
function16
solutions15
logistics15
we13
chain12
more12
sector12
bnnelxdata12
supply11
freight11
documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrackvalue10
number10
09
documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttracksubmit9
enter9
do9
enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrack9
fnshowcrossrefpar1taskcentertaskcentertabsitem1229046233349parexpandablelinkinsideparsysfasttrack9
script8
service8
please8
selectedvalbrand8
international8
global8
java8
track8
selectedbrand7
sel7
time7
air7
new7
select7
error7
business7
ship7
null7
get7
all6
code6
amp6
warehousing6
email6
mydhl5
ecommerce5
shipping5
campaignnameold5
provide5
industry5
documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrackvalue5
shipment5
changes5
start5
our5
foundsearchmatch5
fnftstripbnnelxdata14
screen4
present4
documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttracksubmit4
clean4
message4
bnnelxdata14
documentgetelementbyidelementidinnerhtml4
14
ifcharactercode4
charactercode4
24
innermsg4
formuniqueid4
cookieval4
brand4
documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrackvalue4
interactive4
fnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrack4
hideshipmenttype4
browser4
enable4
required4
results4
istaskcenterdocumentgetelementbyidtaskcenteridvalue4
height800width900left100top100toolbaryeslocationyesdirectoriesyesstatusyesmenubaryesscrollbarsyescopyhistorynoresizableyes4
features4
erroremptysuniqueid4
fnftupdateuiemptytracks4
ifbnnelxdatalength04
iffnftstripinnermsg4
pass4
inside4
alertinside4
check4
benelux4
enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelinkf17cinsideparsysfasttrack4
country4
34
searchmatchwith4
deliver4
obj4
online4
their4
rail4
nohelpicon4
remove4
help4
contact4
customers4
distribution4
querystring4
theform4
critical4
delivery4
44
information4
skip4
flag4
flag24
hbnxx3
httpsdhlidhlcomdhli-clientpublictrackingsearchtypehbnsearchvalue3
enablewebtrendsfasttrackcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrack3
documentgetelementbyidtrackingindexfastcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttracksubmit3
fnshowcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink0insideparsysfasttrack3
seloptionsselselectedindexvalue3
responsibility3
53
company3
working3
crnxx3
selectedbrandoptionsselectedbrandselectedindexvalue3
security3
transportation3
linkcontainerleft3
scam3
important3
expireday3
fpcdomain3
warning3
documentgetelementbyidawbcrossrefpar1taskcentertaskcentertabsitem1229046248070parexpandablelink75ainsideparsysfasttrackvalue3
tags3
type3
tab3
domestic3
customs3
httpsdhlidhlcomdhli-clientpublictrackingsearchtypecrnsearchvalue3
id3
across3
worldwide3
road3
world3
allmatch3
jquerydocumentreadyfunction3
aerospace3
automotive3
numbers3
fashion3
products3
costs3
technology3
wordlist3
dijitbyidmainnewslisttabcontainerteaserrotatorselectchildtabpropid3
fast3
competitive3
off3
63
retail3
change3
quote3
e-commerce3
forwarding3
deliveries3
people3
postal3
taskcenterwebtrends3
undefined3

What are the nameservers for dhl.com.hk?

Dhl.com.hk Domain Nameserver Information

HostIP AddressCountry
ns4.dhl.com 165.72.192.16United States United States
ns6.dhl.com 199.40.254.166United States United States

Dhl.com.hk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Dhl.com.hk is a scam?