DHL Privatkunden - Paketversand und Paketempfang mit DHL

Safety: High trust score
Year Founded: 2021
Global Traffic Rank: 3,437
Estimated Worth: $4,750,920

Günstig, schnell und zuverlässig: Ihr Paketversand mit DHL Paket. Versenden Sie Päckchen und Pakete in über 220 Länder mit dem führenden Paketdienstleister. Sparen Sie mit der Online Frankierung und nutzen Sie deutschlandweit über 28.000 Postfilialen, Paketshops, Packstationen und Paketboxen.



Domain summary

Last updated
2021-04-08
Domain label
dhl
Domain extension
de
Global Traffic Rank
3,437
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$4,750,920
Estimated daily income
$4,399
Estimated monthly income
$133,803

Rank summary

How is dhl.de ranked relative to other sites:

Percentage of visits to dhl.de from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Dhl.de registered?
A: Dhl.de was registered 6 days, 23 hours, 14 minutes, 23 seconds ago on Thursday, April 8, 2021.
Q: When was the WHOIS for Dhl.de last updated?
A: The WHOIS entry was last updated 1 year, 3 weeks, 1 day, 23 hours, 14 minutes, 23 seconds ago on Monday, March 23, 2020.
Q: What are Dhl.de's nameservers?
A: DNS for Dhl.de is provided by the following nameservers:
  • a1-52.akam.net
  • a12-66.akam.net
  • a13-66.akam.net
  • a16-66.akam.net
  • a2-65.akam.net
  • a3-66.akam.net
Q: Who is the registrar for the Dhl.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Dhl.de?
A: Dhl.de ranks 3,437 globally on Alexa. Dhl.de has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Dhl.de each day?
A: Dhl.de receives approximately 549,838 visitors and 4,398,704 page impressions per day.
Q: What IP address does Dhl.de resolve to?
A: Dhl.de resolves to the IPv4 address 51.137.13.106.
Q: In what country are Dhl.de servers located in?
A: Dhl.de has servers located in the Netherlands.
Q: What webserver software does Dhl.de use?
A: Dhl.de is powered by IPNP webserver.
Q: Who hosts Dhl.de?
A: Dhl.de is hosted by Microsoft Corporation in North Holland, Amsterdam, Netherlands, 1091.
Q: How much is Dhl.de worth?
A: Dhl.de has an estimated worth of $4,750,920. An average daily income of approximately $4,399, which is roughly $133,803 per month.

Dhl.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Dhl.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Dhl.de

H1 Headings

4 :
  1. JÜRGEN VOGEL ALS CHECKER "Ist digital einfacher? Ich habe das mal gecheckt."
  2. JÜRGEN VOGEL ALS CHECKER "Ist digital einfacher? Ich habe das mal gecheckt."
  3. CLICK & BRING Express-Sendung online buchen und einfach in der Filiale abgeben
  4. CLICK & BRING Express-Sendung online buchen und einfach in der Filiale abgeben

H2 Headings

0 :

H3 Headings

7 :
  1. Keine Pakete mehr verpassen
  2. Versand berechnen und online sparen
  3. DHL Standorte in Ihrer Nähe
  4. DHL ist Ihr zuverlässiger Partner für den geschäftlichen Versand
  5. Pakete versenden
  6. Pakete empfangen
  7. Häufig gestellte Fragen

H4 Headings

7 :
  1. PAKETVERSAND
  2. EXPRESSVERSAND
  3. LOGISTIKLÖSUNGEN
  4. Privatkunden
  5. Geschäftskunden
  6. Unternehmen
  7. Social

H5 Headings

14 :
  1. Ihre Sitzung läuft bald ab
  2. Ihre Sitzung läuft bald ab.
  3. Sie wurden automatisch ausgeloggt.
  4. Sie wurden automatisch ausgeloggt.
  5. Ihre Sitzung läuft bald ab
  6. DHL Ablageort
  7. DHL Packstation
  8. Paketankündigung erhalten
  9. Verfügbare Services
  10. Haftung bis 500 EUR und Sendungsverfolgung
  11. DHL Päckchen S bis 2 kg DHL Päckchen S bis 2 kg Päckchen S bis 2 kg und bis 35 x 25 x 10 cm. Online frankieren und beim Erwerb von Online-Sparsets gegenüber einzelnen Frankierungen sparen.
  12. DHL Päckchen S bis 2 kg
  13. Standorte finden
  14. Pakete mit dem Handy frankieren

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

16 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

116:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Dhl.de

targetedcomponentfindredesignchildrenlengthmaxwidth 767pxhandlevisibility functiontargetingid vardatatargetingid targetedcomponenttoggleclasshidebeing targeted ifcontentdedeprivatkundenjcrcontentparresponsivegrid141544131responsiveparimagetop3columnsset classcertain experiences varhandlevisibilitytargetingidexperienceswhile being targeted5000 elseelem varcqcontentdedeprivatkundenjcrcontentparresponsivegrid141544131responsiveparimagetop3columns2093837610cssvisibilityvarservicesrundnulldhl dhllib dhllibisauthorinstancerefreshtargetingcomponentstargetingid documentaddeventlistenerdomcontentloadeddernicht mehr aktivsendungenthiskeyitems while beingvorrefreshtargetingcomponentscqcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem629246477cssvisibilityvar refreshtargetingcomponentsfalsehandling for teaserif contexthubeach componentschutz ihrer persnlichenif targetingid targetingidelem var contentelemcssclassesports contentconteachfunctionindex elemdhl kundenkontocontentelemremoveattrclass0lngere zeitbitte whlenmake the targeted5strues bislngere zeit nichtzypernweiter umkerneljs contentelemfadeinbittetargetedcomponent targetingidclosesttarget onlyafter 5svisible contexthubsegmentenginepageinteractionteaserdhllibvisible 5000 medialuft bald0 set classnichtsitzung luftihreheightbald ab zumkerneljs contentelemfadein handledatadataforeachfunctionevdatacomponents whichmaxwidthdifferentopenloginsttargeted content visibleuilibisinternetexplorer targetedcomponentfindredesignchildrenlength 0hide single stageexperiences varshow samerefreshtargetingcomponents functiontargetingidstrategy trackingurlberechnenmodify domcontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsivepartextteaser2023913653zum schutz ihreruhr am nchstenif dhl dhllibdatadatastandorte findendatadataforeachfunctionevdata if evdatakeyum diepersnlichen daten werden1contentelemattrclass if0 hide singlecontexthubeventing contexthubeventingoncontexthubconstantseventteaserloaded functioneventmarkuptargetedcomponenthideuiloghandlevar targetingid0 targetedcomponenthide ifkgcontentelemclosestcampaignaddclasscontentelemcssclassesihre sitzungauf weiter um500 eurab zumbequem0 ifweil sie lngerepackstationif nodhllibisauthorinstance handle markupvisibilitycontentdedeprivatkundenjcrcontentparresponsivegrid141544131responsiveparimagetop3columns2093837610no teaserscontentelemremoveattrclass smoothuhr amcontentdedeprivatkundenjcrcontentparresponsivegrid909479620responsivepararticleaktiv warenstructuretargetedelementseachfunction ifless targetedcomponentaddclassie11 varcqcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem1433189567cssvisibility visiblestagevar isteaser targetedcomponentfindteaserlengthif targetingidzeit nichtsiehide singlefunctionevent data datadataforeachfunctionevdatacalc342px 08data datadataforeachfunctionevdata ifcontentdedeprivatkundenjcrcontentparresponsivegrid1037408576responsivepararticlepublish var targetingidif no teaserscomponentwerdenprivatkundenconfiguredif windowcontexthubihrer persnlichen datentargetingidclosesttarget only modifyconfindividually butpreisbersichtkg bisdaten werdenfunction if contexthubcontentconteachfunctionindex elem varauf weitervar targetedcomponentifisteaser uilibisinternetexplorer targetedcomponentfindredesignchildrenlengthzumcqcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem629246477cssvisibility visiblemehr aktivhilfewerktag vorvisible ifstrategyif contexthub contexthubeventingkerneljsdhllibisauthorinstance handlerund umablageortvisibleif windowcontexthub contexthubsegmentengineaemcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem1433189567respect to differentfunctioneventcomponent with idtargetedcomponentfindredesignchildrenbeinguilibisinternetexplorer5000 dhlcontexthub contexthubeventing contexthubeventingoncontexthubconstantseventteaserloadedwhichtargetedcomponentfindteaserlengthsendungsverfolgungcqcontentdedeprivatkundenjcrcontentparresponsivegrid165282753responsivepararticlecssvisibility visibletrackingurlmakeampaem kerneljscqcontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsivepartextteaser478312987cssvisibility visiblecomponent individuallycontentelemattrclasstargetingid targetingid thiskeydata correctstandortevisible if nomeine5smoothcqcontentdedeprivatkundenjcrcontentparresponsivegrid141544131responsiveparimagetop3columnscssvisibility visibleaem kerneljs contentelemfadeinhandledeutschlandssie aufmedia maxwidth 767pxortbald abbis 2 kgwietargetedcomponentfindredesignchildren specialwerecqcontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsivepartextteaser2023913653cssvisibilityihre paketetargetedelementseachfunction if targetingidvar handlevisibilitycqcontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsivepartextteaser2023913653cssvisibility visibleminuten inaktivittcontexthubeventingoncontexthubconstantseventteaserloaded functionevent datarefreshtargetingcomponents functiontargetingid vartargetedcomponentcqcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem1433189567cssvisibilitysendungsinglediejetztcontent visible ifhandle visibilityid targetingid targetedcomponenttoggleclasshidevar targetedelementscqcontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsiveparlinkbuttoncssvisibilitytargeted ifcqcontentdedeprivatkundenjcrcontentparresponsivegrid909479620responsivepararticlecssvisibility visibledomlngerecqcontentdedeprivatkundenjcrcontentparresponsivegrid165282753responsivepararticlecssvisibilitytargetedcomponentaddclassie11 varheight calc342pxklicken sieversenden und empfangennchsten werktagvar contentelemcssclasses contentelemattrclassvar contentelemtargetingid thiskeystructure for targetedvisibility of targetedtargetedcomponent targetingidclosesttarget uiloghandle0 targetedcomponenthideonline frankierungdie aktuellenmehrtargetedcomponentfindstageitemlengthtargetedcomponenthide ifif contentelemcssclassesincludesicontextteaseristeaserpckchen s bistargetedcomponenthide if dhlcontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsivepartextteaserfrankierungbezahlen7zum schutzless targetedcomponentaddclassie11am nchstenindividually but onlytargetedcomponentfindredesignchildrenlength 0dhlprivatkundenif contentelemcssclassesincludesicontextteaser contentelemclosestcampaignaddclasscontentelemcssclasses60 cmcontexthubsegmentengine contexthubjqfunction contexthubeventingoncontexthubconstantseventteaserloadeddifferent view portssamenach 15 minutencontexthubeinfachvar contentcont targetedcomponentfindredesignchildrenview ports contentconteachfunctionindexzeitweilelse makegeschftskundenafter 5s settimeoutfunctionsparenwhile beingwindowcontexthubmarkup changeswere loadedfilialecontexthubeventing contexthubeventingoncontexthubconstantseventteaserloadedcalc342pxaktuellen inhalte ausgeblendetdhllibisauthorinstancesie ihre paketeweitertargetedcomponentfindredesignchildrenlength 0 setaktuellen inhalteportsdifferent viewcertainrund um diedom ifbaldcqcontentdedeprivatkundenjcrcontentparresponsivegrid141544131responsiveparimagetop3columnscssvisibilitymodifytargeted components whichcqcontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsivepartextteasercssvisibilitybis 2var refreshtargetingcomponents functiontargetingidnhedatadata targetedelementseachfunctionabgebencontentconteachfunctionindex elemcqcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem1891917964cssvisibility visibledhl packstationcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem629246477imdie aktuellen inhaltemarkup structurecontentelemcontexthubeventingoncontexthubconstantseventteaserloaded functioneventthiskey handlevisibilitytargetingidaufcontentelemcssclassesincludesicontextteaser contentelemclosestcampaignaddclasscontentelemcssclasses contentelemremoveattrclassihre sitzung luftausgeblendet weil siecontentconteachfunctionindexvisible 5000sie ihre767pxskongoeachtargetingiddhllib dhllibisauthorinstance handletargeting for eachdummyplaceholderimageif isteaser uilibisinternetexplorerpckchen sempfangentargetedcomponentfindstageitemlength 0sitzung luft baldif targetedcomponentfindstageitemlength 00 setclassvariantswerden dietargetedcomponenthasdivhidecomponentlength 0targetedcomponenthasdivhidecomponentlengthloaded afterif evdatakeythiskey handlevisibilitytargetingid refreshtargetingcomponentstargetingidsmooth showcontentcontif componentdocumentaddeventlistenerdomcontentloaded functiondisplayihrer nheif dhlwhiledatenonly on publishzurckteasers3targetedcomponenttoggleclasshide targetedcomponenthasdivhidecomponentlength 0luft bald abif targetedcomponentfindstageitemlengthteaserumweil sieichnopakete rundodertargetedcomponentfindredesignchildren special handlingnull makecqcontentdedeprivatkundenjcrcontentparresponsivegrid1037408576responsivepararticlecssvisibilitycqcontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsivepartextteasercssvisibility visibleevdatakeyvar contentcontlassenstrategy trackingurl nullkanalinseltargetingfunctioncontexthubeventingoncontexthubconstantseventteaserloadedvar contentelemcssclassescontexthubsegmentenginepageinteractionteaser locationidcontentelemclosestcampaignaddclasscontentelemcssclasses contentelemremoveattrclass smoothcontentdedeprivatkundenjcrcontentparresponsivegrid165282753responsivepararticlecontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsivepartextteaser478312987targetingidclosesttargetmchtenpakete rund umkeincontentelem elem varcontexthubsegmentenginepageinteractionteasertargetedcomponenttoggleclasshide targetedcomponenthasdivhidecomponentlengtheinenspecial0 hidefindenrepublikalscorrect the markuphidden in certainsingle stagecontentdedeprivatkundenjcrcontentparresponsivegrid141544131responsiveparimagetop3columns1813667924contentelemcssclasses contentelemattrclasssitzungcontentelemcssclasses contentelemattrclass ifzukostenlosvisibility for componentpaketitems whilerefreshtargetingcomponentstargetingid documentaddeventlistenerdomcontentloaded functioncm xeach component individuallytargetedelements datadatauiloghandle visibilitycomponent individually butisteaser targetedcomponentfindteaserlengthcontentcont targetedcomponentfindredesignchildrenhandlingfrhandle markupschutzbismedia maxwidthvar targetedcomponent targetingidclosesttargetlogintargetedelements datadata targetedelementseachfunctionteaser var isteaserexpressdie uhrdata datadataforeachfunctionevdataab zum schutztargetedcomponenthasdivhidecomponentlength 0 hidepaketecontentelemcssclassesincludesicontextteaser contentelemclosestcampaignaddclasscontentelemcssclassestargetingidclosesttarget uiloghandlecontexthubsegmentengineihrerbitte klicken sieum die uhrabcqcontentdedeprivatkundenjcrcontentparresponsivegrid141544131responsiveparimagetop3columns2093837610cssvisibility visibleelsestage itemsbeing targetedonlyfunctiontargetingid varonly modifyinaktivittinhalteweltweitcontexthubsegmentengine contexthubjqfunctionwerktagcontentelemattrclass if contentelemcssclassesincludesicontextteaserklickenbitte whlen siepublish varfrankierenpublishdummyplaceholderimage height calc342px2 kgcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem1114410977contexthub contexthubeventingcontentelemfadeinweiter um zurckzukehrentargeted componentstargetedcomponentfindteaserlength 0 ifversandmarkepckchenisteaser targetedcomponentfindteaserlength 0respectitems5000 mediacontentelemfadein handle visibilityausgeblendetcomponents varelempersnlichencorrectcertain experiencesluftihrnchsten werktag vorwarenfunction ifcqcontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsiveparlinkbuttoncssvisibility visiblevisible contexthubsegmentenginepageinteractionteaser locationidspecial handlingfunctiontargetingidvisible 5000 dhlfunctionevent data correctvar contentelem elemtargetedcomponentfindstageitemlength 0 targetedcomponenthide0 if isteaserhandlevisibilitytargetingid refreshtargetingcomponentstargetingid documentaddeventlistenerdomcontentloadedzustellungidtargetedcomponentfindteaserlength 0lesstargetingid thiskey handlevisibilitytargetingidpakete versendenclass for lesscqcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem1891917964cssvisibilitytargetedcomponentaddclassie11 var contentcontcqcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem1114410977cssvisibility visibledocumentaddeventlistenerdomcontentloaded function ifinhalte ausgeblendet weilsame as aemloadedcqcontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsivepartextteaser478312987cssvisibilitytargetedcomponent targetingidclosesttargets bis 2were loaded aftertargetingidclosesttarget uiloghandle visibilitycontentelemcssclassesincludesicontextteaserversandvar handlevisibility functiontargetingidonlineminutenvon15 minuten inaktivittnchstenhandlevisibilityerfahren dhlcontentelem elem5s settimeoutfunctionerfahrenum zurckzukehrenonly modify domcmindividuallykundenkontoteaser varcontentelemremoveattrclass smooth showcontent visiblechanges from targetingteasers wereid targetingidbitte klickentargeted components varwastriggeredisteaser uilibisinternetexplorernicht mehr4handlevisibility functiontargetingidtargetedcomponenttoggleclasshideports contentconteachfunctionindexfunction if windowcontexthubsie auf weiter08dhl dhllibcqcontentdedeprivatkundenjcrcontentparresponsivegrid1037408576responsivepararticlecssvisibility visiblevar isteaserdhl standorteklicken sie aufwerden die aktuellen15 minutencqcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem1114410977cssvisibilitymediahiddeneurtargeted contentviewdhl2aftersettimeoutfunctionhandle markup changesif isteaservisible 5000 elsetargeted if targetedcomponentfindstageitemlengthexperiences var handlevisibilityfunctiontargetingid var targetedcomponentcomponents var refreshtargetingcomponentshandlevisibilitytargetingid refreshtargetingcomponentstargetingidversendensie lngerewhlensettargetingidclosesttarget onlycontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsiveparlinkbuttonbutrefreshtargetingcomponentstargetingidchangesuilibisinternetexplorer targetedcomponentfindredesignchildrenlengthcontexthubeventinguhrfunctionevent datakoreawhlen siedhltoolsnegativegap4remtrackingurl null makeihrer persnlichennach 15buchendhllib dhllibisauthorinstancetargetingid targetedcomponenttoggleclasshide targetedcomponenthasdivhidecomponentlengthstage items whilecqcontentdedeprivatkundenjcrcontentparresponsivegrid141544131responsiveparimagetop3columns1813667924cssvisibility5000 media maxwidthtargetingid targetingidcontexthubjqfunction contexthubeventingoncontexthubconstantseventteaserloaded functioneventdom if componentdemcontentelemfadein handleaktivtargetedcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem1891917964componentscontentcont targetedcomponentfindredesignchildren specialhidepertargetedelementseachfunctioncontentcontentelemcssclassesonline frankierenwhich are configuredmehr erfahrenheight calc342px 08teasers were loadeddocumentaddeventlistenerdomcontentloadedmitinhalte ausgeblendet6but onlyzurckzukehrencontexthubjqfunctionvar targetedelements datadatacontexthubjqfunction contexthubeventingoncontexthubconstantseventteaserloadedausgeblendet weilcontentelemclosestcampaignaddclasscontentelemcssclasses contentelemremoveattrclasstargetedelementsaktuellensie lngere zeitpaketankndigungtrackingurl nullshowpersnlichen datendatadataforeachfunctionevdata ifmodify dom ifcqcontentdedeprivatkundenjcrcontentparresponsivegrid141544131responsiveparimagetop3columns1813667924cssvisibility visibledummyplaceholderimage heightkontaktelem var contentelemcqcontentdedeprivatkundenjcrcontentparresponsivegrid909479620responsivepararticlecssvisibilityautomatischlocationidsmooth show sametargetedcomponentaddclassie11mehr erfahren dhlview portsschutz ihrermehr aktiv warensingle stage itemsam nchsten werktagdatadata targetedelementseachfunction ifwindowcontexthub contexthubsegmentengine contexthubjqfunctionteaser with respectnachzeit nicht mehrsaintxihremwindowcontexthub contexthubsegmentenginewerden sieamdaten werden die5000 else makeloaded after 5sno teasers were

Longtail Keyword Density for Dhl.de

KeywordsOccurences
no teasers were28
var targetedcomponent targetingidclosesttarget28
documentaddeventlistenerdomcontentloaded function if28
contexthubeventingoncontexthubconstantseventteaserloaded functionevent data28
were loaded after28
after 5s settimeoutfunction28
functiontargetingid var targetedcomponent28
loaded after 5s28
teasers were loaded28
visible if no28
make the targeted28
if no teasers28
targeted content visible28
content visible if28
targetedcomponenttoggleclasshide targetedcomponenthasdivhidecomponentlength 014
targetedcomponenthasdivhidecomponentlength 0 hide14
0 hide single14
hide single stage14
stage items while14
single stage items14
targetedcomponentfindstageitemlength 0 targetedcomponenthide14
items while being14
while being targeted14
targeted if targetedcomponentfindstageitemlength14
if targetedcomponentfindstageitemlength 014
being targeted if14
visibility for component14
targetingid targetedcomponenttoggleclasshide targetedcomponenthasdivhidecomponentlength14
hidden in certain14
same as aem14
aem kerneljs contentelemfadein14
kerneljs contentelemfadein handle14
contentelemfadein handle visibility14
visibility of targeted14
targeted components which14
certain experiences var14
id targetingid targetedcomponenttoggleclasshide14
experiences var handlevisibility14
var handlevisibility functiontargetingid14
handlevisibility functiontargetingid var14
targetedcomponent targetingidclosesttarget uiloghandle14
targetingidclosesttarget uiloghandle visibility14
targetedcomponenthide if dhl14
component with id14
0 targetedcomponenthide if14
dhllibisauthorinstance handle markup14
if dhl dhllib14
targetingid thiskey handlevisibilitytargetingid14
trackingurl null make14
strategy trackingurl null14
visible contexthubsegmentenginepageinteractionteaser locationid14
datadataforeachfunctionevdata if evdatakey14
data datadataforeachfunctionevdata if14
functionevent data datadataforeachfunctionevdata14
contexthubjqfunction contexthubeventingoncontexthubconstantseventteaserloaded functionevent14
contexthubsegmentengine contexthubjqfunction contexthubeventingoncontexthubconstantseventteaserloaded14
windowcontexthub contexthubsegmentengine contexthubjqfunction14
if windowcontexthub contexthubsegmentengine14
function if windowcontexthub14
refreshtargetingcomponentstargetingid documentaddeventlistenerdomcontentloaded function14
handlevisibilitytargetingid refreshtargetingcomponentstargetingid documentaddeventlistenerdomcontentloaded14
thiskey handlevisibilitytargetingid refreshtargetingcomponentstargetingid14
targetingid targetingid thiskey14
dhl dhllib dhllibisauthorinstance14
component individually but14
dhllib dhllibisauthorinstance handle14
contentelemremoveattrclass smooth show14
handle markup changes14
changes from targeting14
targeting for each14
each component individually14
individually but only14
if targetingid targetingid14
only on publish14
publish var targetingid14
var targetedelements datadata14
targetedelements datadata targetedelementseachfunction14
datadata targetedelementseachfunction if14
targetedelementseachfunction if targetingid14
smooth show same14
which are configured14
contentelemclosestcampaignaddclasscontentelemcssclasses contentelemremoveattrclass smooth14
var refreshtargetingcomponents functiontargetingid14
targetedcomponentfindteaserlength 0 if14
isteaser targetedcomponentfindteaserlength 014
var isteaser targetedcomponentfindteaserlength14
teaser var isteaser14
dom if component14
modify dom if14
only modify dom14
targetingidclosesttarget only modify14
contentelemcssclassesincludesicontextteaser contentelemclosestcampaignaddclasscontentelemcssclasses contentelemremoveattrclass14
refreshtargetingcomponents functiontargetingid var14
components var refreshtargetingcomponents14
if isteaser uilibisinternetexplorer14
targeted components var14
structure for targeted14
correct the markup14
functionevent data correct14
contexthubeventing contexthubeventingoncontexthubconstantseventteaserloaded functionevent14
contexthub contexthubeventing contexthubeventingoncontexthubconstantseventteaserloaded14
if contexthub contexthubeventing14
function if contexthub14
visible 5000 else14
5000 else make14
0 if isteaser14
targetedcomponent targetingidclosesttarget only14
isteaser uilibisinternetexplorer targetedcomponentfindredesignchildrenlength14
different view ports14
uilibisinternetexplorer targetedcomponentfindredesignchildrenlength 014
contentelemcssclasses contentelemattrclass if14
var contentelemcssclasses contentelemattrclass14
elem var contentelemcssclasses14
contentelem elem var14
var contentelem elem14
elem var contentelem14
contentconteachfunctionindex elem var14
ports contentconteachfunctionindex elem14
view ports contentconteachfunctionindex14
if contentelemcssclassesincludesicontextteaser contentelemclosestcampaignaddclasscontentelemcssclasses14
respect to different14
less targetedcomponentaddclassie11 var14
teaser with respect14
targetedcomponentfindredesignchildrenlength 0 set14
0 set class14
class for less14
contentelemattrclass if contentelemcssclassesincludesicontextteaser14
targetedcomponentaddclassie11 var contentcont14
handling for teaser14
contentcont targetedcomponentfindredesignchildren special14
targetedcomponentfindredesignchildren special handling14
var contentcont targetedcomponentfindredesignchildren14
sie ihre pakete8
height calc342px 086
zum schutz ihrer5
schutz ihrer persnlichen5
ihrer persnlichen daten5
persnlichen daten werden5
am nchsten werktag5
rund um die4
bis 2 kg4
bitte whlen sie4
pakete rund um4
um die uhr4
visible 5000 dhl3
versenden und empfangen3
visible 5000 media3
mehr erfahren dhl3
5000 media max-width3
dummyplaceholderimage height calc342px3
nchsten werktag vor3
uhr am nchsten3
pckchen s bis3
media max-width 767px3
ihre sitzung luft3
sitzung luft bald3
weil sie lngere3
luft bald ab3
bald ab zum3
ab zum schutz3
daten werden die3
werden die aktuellen3
die aktuellen inhalte3
aktuellen inhalte ausgeblendet3
inhalte ausgeblendet weil3
ausgeblendet weil sie3
sie lngere zeit3
15 minuten inaktivitt3
lngere zeit nicht3
zeit nicht mehr3
nicht mehr aktiv3
mehr aktiv waren3
bitte klicken sie3
klicken sie auf3
sie auf weiter3
auf weiter um3
weiter um zurckzukehren3
nach 15 minuten3
s bis 23
documentaddeventlistenerdomcontentloaded function29
if no28
function if28
contexthubeventingoncontexthubconstantseventteaserloaded functionevent28
elem var28
functionevent data28
targeted content28
content visible28
functiontargetingid var28
var targetedcomponent28
no teasers28
teasers were28
were loaded28
loaded after28
after 5s28
5s settimeoutfunction28
visible 500028
targetedcomponent targetingidclosesttarget28
targeted components28
visible if28
items while14
while being14
being targeted14
targeted if14
if dhl14
if targetedcomponentfindstageitemlength14
targetedcomponentfindstageitemlength 014
0 targetedcomponenthide14
targetedcomponenthide if14
single stage14
stage items14
id targetingid14
hide single14
components which14
contentelemremoveattrclass smooth14
smooth show14
show same14
aem kerneljs14
kerneljs contentelemfadein14
contentelemfadein handle14
handle visibility14
certain experiences14
0 hide14
experiences var14
var handlevisibility14
targetingidclosesttarget uiloghandle14
uiloghandle visibility14
targetingid targetedcomponenttoggleclasshide14
targetedcomponenttoggleclasshide targetedcomponenthasdivhidecomponentlength14
targetedcomponenthasdivhidecomponentlength 014
handlevisibility functiontargetingid14
each component14
dhl dhllib14
if evdatakey14
if windowcontexthub14
windowcontexthub contexthubsegmentengine14
contexthubsegmentengine contexthubjqfunction14
contexthubjqfunction contexthubeventingoncontexthubconstantseventteaserloaded14
data datadataforeachfunctionevdata14
datadataforeachfunctionevdata if14
visible contexthubsegmentenginepageinteractionteaser14
handlevisibilitytargetingid refreshtargetingcomponentstargetingid14
contexthubsegmentenginepageinteractionteaser locationid14
strategy trackingurl14
trackingurl null14
null make14
5000 else14
else make14
refreshtargetingcomponentstargetingid documentaddeventlistenerdomcontentloaded14
thiskey handlevisibilitytargetingid14
dhllib dhllibisauthorinstance14
but only14
dhllibisauthorinstance handle14
handle markup14
markup changes14
contentelemcssclassesincludesicontextteaser contentelemclosestcampaignaddclasscontentelemcssclasses14
component individually14
individually but14
publish var14
targetingid thiskey14
var targetingid14
var targetedelements14
targetedelements datadata14
datadata targetedelementseachfunction14
targetedelementseachfunction if14
if targetingid14
targetingid targetingid14
contentelemclosestcampaignaddclasscontentelemcssclasses contentelemremoveattrclass14
contentelemattrclass if14
if contentelemcssclassesincludesicontextteaser14
only modify14
targetedcomponentfindteaserlength 014
isteaser targetedcomponentfindteaserlength14
var isteaser14
teaser var14
if component14
dom if14
modify dom14
targetingidclosesttarget only14
isteaser uilibisinternetexplorer14
refreshtargetingcomponents functiontargetingid14
var refreshtargetingcomponents14
components var14
markup structure14
data correct14
contexthubeventing contexthubeventingoncontexthubconstantseventteaserloaded14
contexthub contexthubeventing14
if contexthub14
if isteaser14
0 if14
uilibisinternetexplorer targetedcomponentfindredesignchildrenlength14
special handling14
contentelemcssclasses contentelemattrclass14
var contentelemcssclasses14
contentelem elem14
var contentelem14
contentconteachfunctionindex elem14
ports contentconteachfunctionindex14
targetedcomponentfindredesignchildrenlength 014
different view14
view ports14
targetedcomponentfindredesignchildren special14
contentcont targetedcomponentfindredesignchildren14
var contentcont14
targetedcomponentaddclassie11 var14
less targetedcomponentaddclassie1114
set class14
0 set14
ihre pakete9
mehr erfahren8
sie ihre8
dhl packstation7
height calc342px6
dhl kundenkonto6
cm x6
whlen sie6
calc342px 086
rund um5
zum schutz5
schutz ihrer5
ihrer persnlichen5
persnlichen daten5
daten werden5
nchsten werktag5
am nchsten5
die uhr4
pakete rund4
um die4
online frankierung4
bis 24
bitte whlen4
2 kg4
kg bis3
cqcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem1433189567cssvisibility visible3
erfahren dhl3
cqcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem629246477cssvisibility visible3
cqcontentdedeprivatkundenjcrcontentparresponsivegrid165282753responsivepararticlecssvisibility visible3
cqcontentdedeprivatkundenjcrcontentparresponsivegrid141544131responsiveparimagetop3columnscssvisibility visible3
cqcontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsivepartextteaser2023913653cssvisibility visible3
cqcontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsivepartextteaser478312987cssvisibility visible3
cqcontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsivepartextteasercssvisibility visible3
5000 dhl3
cqcontentdedeprivatkundenjcrcontentparresponsivegrid141544131responsiveparimagetop3columns1813667924cssvisibility visible3
cqcontentdedeprivatkundenjcrcontentparresponsivegrid141544131responsiveparimagetop3columns2093837610cssvisibility visible3
ihrer nhe3
cqcontentdedeprivatkundenjcrcontentparresponsivegrid909479620responsivepararticlecssvisibility visible3
s bis3
pckchen s3
500 eur3
uhr am3
cqcontentdedeprivatkundenjcrcontentparresponsivegrid1037408576responsivepararticlecssvisibility visible3
60 cm3
cqcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem1114410977cssvisibility visible3
werktag vor3
ihre sitzung3
dummyplaceholderimage height3
ausgeblendet weil3
mehr aktiv3
nicht mehr3
zeit nicht3
lngere zeit3
sie lngere3
weil sie3
inhalte ausgeblendet3
bitte klicken3
aktuellen inhalte3
die aktuellen3
werden die3
ab zum3
bald ab3
luft bald3
aktiv waren3
klicken sie3
max-width 767px3
online frankieren3
media max-width3
5000 media3
cqcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem1891917964cssvisibility visible3
sitzung luft3
dhl standorte3
standorte finden3
pakete versenden3
sie auf3
werden sie3
minuten inaktivitt3
15 minuten3
nach 153
um zurckzukehren3
weiter um3
auf weiter3
cqcontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsiveparlinkbuttoncssvisibility visible3
if161
var148
visible70
targeted70
058
targetingid56
dhl47
component42
sie40
documentaddeventlistenerdomcontentloaded31
function31
functionevent30
data30
settimeoutfunction29
components28
visibility28
handle28
elem28
128
contexthubeventingoncontexthubconstantseventteaserloaded28
markup28
5s28
functiontargetingid28
targetedcomponent28
targetingidclosesttarget28
only28
teaser28
isteaser28
make28
content28
no28
teasers28
were28
loaded28
after28
pakete21
bis16
ihre16
windowcontexthub16
else15
targeting14
special14
targetedelements14
contentconteachfunctionindex14
ports14
view14
different14
datadata14
targetedelementseachfunction14
thiskey14
respect14
handling14
handlevisibilitytargetingid14
refreshtargetingcomponentstargetingid14
targetedcomponentfindredesignchildren14
contexthubsegmentengine14
contentelemcssclasses14
contexthubjqfunction14
datadataforeachfunctionevdata14
contentcont14
evdatakey14
contexthubsegmentenginepageinteractionteaser14
locationid14
variants14
targetedcomponentaddclassie1114
less14
strategy14
trackingurl14
null14
class14
contentelem14
contentelemattrclass14
changes14
id14
dhllibisauthorinstance14
dhllib14
targetedcomponenthide14
targetedcomponentfindstageitemlength14
being14
while14
items14
stage14
single14
hide14
each14
targetedcomponenthasdivhidecomponentlength14
targetedcomponenttoggleclasshide14
set14
uiloghandle14
contentelemcssclassesincludesicontextteaser14
kerneljs14
contentelemclosestcampaignaddclasscontentelemcssclasses14
contentelemremoveattrclass14
smooth14
show14
same14
aem14
contentelemfadein14
individually14
publish14
but14
which14
configured14
hidden14
experiences14
handlevisibility14
certain14
targetedcomponentfindredesignchildrenlength14
correct14
mehr14
uilibisinternetexplorer14
contexthub14
contexthubeventing14
versenden14
structure14
modify14
targetedcomponentfindteaserlength14
dom14
refreshtargetingcomponents14
online13
der11
packstation11
zum10
die10
erfahren10
cm10
empfangen9
amp9
fr9
oder8
x8
republik8
um8
bitte8
ihrer8
paket8
von7
uhr7
kg7
auf7
daten7
ablageort7
geschftskunden6
26
kundenkonto6
mit6
whlen6
ab6
jetzt6
werktag6
werden6
height6
calc342px6
086
sendungen6
schutz5
kanalinsel5
paketankndigung5
lassen5
am5
nchsten5
standorte5
eur5
persnlichen5
waren5
weiter5
meine5
pckchen5
nach5
versand5
rund5
per5
35
hilfe5
automatisch5
ihr5
frankieren5
false4
kongo4
dem4
ich4
einfach4
saint4
dhltoolsnegativegap-4rem4
als4
44
login4
einen4
openlogin4
nhe4
wastriggered4
display4
zu4
conf4
services4
vor4
frankierung4
korea3
im3
contentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsiveparlinkbutton3
53
sparen3
contentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsivepartextteaser20239136533
berechnen3
cqcontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsiveparlinkbuttoncssvisibility3
true3
cqcontentdedeprivatkundenjcrcontentparresponsivegrid141544131responsiveparimagetop3columns1813667924cssvisibility3
cqcontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsivepartextteaser2023913653cssvisibility3
contentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsivepartextteaser4783129873
cqcontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsivepartextteaser478312987cssvisibility3
bequem3
63
sendungsverfolgung3
s3
deutschlands3
73
ort3
contentdedeprivatkundenjcrcontentparresponsivegrid909479620responsivepararticle3
st3
cqcontentdedeprivatkundenjcrcontentparresponsivegrid909479620responsivepararticlecssvisibility3
luft3
contentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsivepartextteaser3
zypern3
cqcontentdedeprivatkundenjcrcontentparresponsivegrid1297562873responsivepartextteasercssvisibility3
express3
contentdedeprivatkundenjcrcontentparresponsivegrid141544131responsiveparimagetop3columns18136679243
bald3
cqcontentdedeprivatkundenjcrcontentparresponsivegrid141544131responsiveparimagetop3columns2093837610cssvisibility3
versandmarke3
klicken3
zurckzukehren3
minuten3
inaktivitt3
contentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem18919179643
mchten3
privatkunden3
kein3
kostenlos3
zurck3
buchen3
aktiv3
preisbersicht3
sitzung3
weltweit3
abgeben3
finden3
zustellung3
sendung3
kontakt3
filiale3
bezahlen3
cqcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem1891917964cssvisibility3
nicht3
contentdedeprivatkundenjcrcontentparresponsivegrid141544131responsiveparimagetop3columns20938376103
cqcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem1114410977cssvisibility3
ihrem3
cqcontentdedeprivatkundenjcrcontentparresponsivegrid141544131responsiveparimagetop3columnscssvisibility3
contentdedeprivatkundenjcrcontentparresponsivegrid141544131responsiveparimagetop3columns3
wie3
cqcontentdedeprivatkundenjcrcontentparresponsivegrid1037408576responsivepararticlecssvisibility3
contentdedeprivatkundenjcrcontentparresponsivegrid1037408576responsivepararticle3
cqcontentdedeprivatkundenjcrcontentparresponsivegrid165282753responsivepararticlecssvisibility3
contentdedeprivatkundenjcrcontentparresponsivegrid165282753responsivepararticle3
cqcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem1433189567cssvisibility3
contentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem14331895673
contentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem11144109773
zeit3
cqcontentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem629246477cssvisibility3
contentdedeprivatkundenjcrcontentstageparsysresponsiveparstageitem6292464773
dummyplaceholderimage3
767px3
max-width3
media3
aktuellen3
inhalte3
ausgeblendet3
weil3
lngere3
dhlprivatkunden3

Who hosts Dhl.de?

Dhl.de Hosting Provider Information

Hosted IP Address:51.137.13.106
Hosted Hostname:51.137.13.106
Service Provider:Microsoft Corporation
Hosted Country:NetherlandsNL
Location Latitude:52.3534
Location Longitude:4.9087
Webserver Software:IPNP

Is "Microsoft Corporation" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
Microsoft Corporation
0.3289%

HTTP Header Analysis for Dhl.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html; charset=utf-8
Server: IPNP
Producers: IPNP-P-CP
Referrer-Policy: same-origin
Strict-Transport-Security: max-age=31556926; includeSubDomains
Accept-Ranges: bytes
Vary: Accept-Encoding
Content-Encoding: gzip
X-DPWN-IS-SECURE: 1
X-Frame-Options: SAMEORIGIN
X-XSS-Protection: 1; mode=block
X-DNS-Prefetch-Control: off
X-Content-Type-Options: NOSNIFF
X-Akamai-Transformed: 9 - 0 pmb=mTOE,1
Cache-Control: must-revalidate, max-age=3523
Expires: Thu, 08 Apr 2021 15:23:09 GMT
Date: Thu, 08 Apr 2021 14:24:26 GMT
Content-Length: 29418
Connection: keep-alive

Dhl.de Domain Nameserver Information

HostIP AddressCountry
a1-52.akam.net 193.108.91.52
a12-66.akam.net 184.26.160.66
a13-66.akam.net 2.22.230.66
a16-66.akam.net 23.211.132.66
a2-65.akam.net 95.100.174.65
a3-66.akam.net 96.7.49.66


Need to find out who hosts Dhl.de?


Domain Registration (WhoIs) information for Dhl.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: dhl.de
Nserver: a12-66.akam.net
Nserver: a13-66.akam.net
Nserver: a1-52.akam.net
Nserver: a16-66.akam.net
Nserver: a2-65.akam.net
Nserver: a3-66.akam.net
Status: connect
Changed: 2020-03-23T09:17:53+01:00

Websites with Similar Names

Dhl-24.com
dhl-24.com
Dhl-bh.com
炸金花 | 腾讯游戏
Dhl-bolivia.org
DHL | Bolivia | ¡LO ASALTAMOS CON FACTURA EN MANO!
Dhl-constructions.com
DHL, constructeur maison individuelle à Biscarosse
Dhl-courier.com
DHL Services

Recently Updated Websites

Gisit.it (1 second ago.)Pharmaswitch.com (2 seconds ago.)Goldstienauto.com (2 seconds ago.)Pingtest.eu (3 seconds ago.)Iaf-ph.org (3 seconds ago.)Jdlawgroup.com (3 seconds ago.)Makhwahedu.net (3 seconds ago.)Tipzin.com (3 seconds ago.)Solacommunitypeacecenter.org (4 seconds ago.)Cdn-consular.co.uk (4 seconds ago.)Buyer.pet (4 seconds ago.)Bohrenslogistics.net (4 seconds ago.)Romz.org (4 seconds ago.)Herbivore.com (5 seconds ago.)Votethebody.us (5 seconds ago.)Bobbondurantofficial.com (5 seconds ago.)Ellaroreads.com (5 seconds ago.)Mymytmobile.com (5 seconds ago.)Leslittles.com (6 seconds ago.)Lovehackerbook.com (6 seconds ago.)Flybywings.co.uk (7 seconds ago.)Adricons.com (7 seconds ago.)Pragmills.com (7 seconds ago.)Codewhoop.com (7 seconds ago.)Msmountwashington.com (7 seconds ago.)Buystew.com (7 seconds ago.)Friggcapital.com (7 seconds ago.)Shelters.ca (7 seconds ago.)Barclaycard-pvn.de (7 seconds ago.)Yibobet4438.com (7 seconds ago.)

Recently Searched Keywords

field survey (1 second ago.)‘भारत में प्रति मिलियन आबादी पर कोविड संक्रमितों की संख्या सबसे कम ‘ (4 seconds ago.)instructions for use (4 seconds ago.)free l3l4 ddos (5 seconds ago.)currentelementlength (5 seconds ago.)back glass (6 seconds ago.)made history (7 seconds ago.)weniger (8 seconds ago.)fetish and niche membership listing (9 seconds ago.)secure mailboxes.com (10 seconds ago.)plaid 3649900 mantoni (12 seconds ago.)counter4200829736btnbackground0 (13 seconds ago.)issi (13 seconds ago.)adult and part time (14 seconds ago.)ağız bakım (16 seconds ago.)mực khô loại 2 (16 seconds ago.)‘भारत में प्रति मिलियन आबादी पर कोविड संक्रमितों की संख्या सबसे कम ‘ (18 seconds ago.)infringement published (18 seconds ago.)importantpadding-left20px importantpadding-right20px important (19 seconds ago.)‘भारत में प्रति मिलियन आबादी पर कोविड संक्रमितों की संख्या सबसे कम ‘ (19 seconds ago.)ontarget (20 seconds ago.)市总工会 (21 seconds ago.)office organization (22 seconds ago.)brythoniaid male voice choir welsh (25 seconds ago.)timmins (25 seconds ago.)aufgaben und ziele (27 seconds ago.)afro (28 seconds ago.)bagpacktours (29 seconds ago.)breakpoint sm image (31 seconds ago.)ut libero malesuada (32 seconds ago.)