Did it Leak - providing the South with quality plumbing services

Safety: Low trust score
Year Founded: 26
Global Traffic Rank: Unknown
Estimated Worth: $9

providing the South with quality plumbing services



Domain summary

Last updated
2021-03-30
Domain label
diditleak
Domain extension
co.uk
Domain registered:
26-Dec-2012
Domain updated:
23-Dec-2020
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Diditleak.co.uk registered?
A: Diditleak.co.uk was registered 8 years, 7 months, 3 days, 18 hours, 49 minutes, 17 seconds ago on Wednesday, December 26, 2012.
Q: When was the WHOIS for Diditleak.co.uk last updated?
A: The WHOIS entry was last updated 7 months, 6 days, 18 hours, 49 minutes, 17 seconds ago on Wednesday, December 23, 2020.
Q: Who is the registrar for the Diditleak.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Diditleak.co.uk?
A: Diditleak.co.uk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Diditleak.co.uk each day?
A: Diditleak.co.uk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Diditleak.co.uk resolve to?
A: Diditleak.co.uk resolves to the IPv4 address 51.77.116.174.
Q: In what country are Diditleak.co.uk servers located in?
A: Diditleak.co.uk has servers located in the France.
Q: What webserver software does Diditleak.co.uk use?
A: Diditleak.co.uk is powered by Apache/2.4.41 (Ubuntu) webserver.
Q: Who hosts Diditleak.co.uk?
A: Diditleak.co.uk is hosted by OVH SAS in France.
Q: How much is Diditleak.co.uk worth?
A: Diditleak.co.uk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Diditleak.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Diditleak.co.uk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Diditleak.co.uk

H1 Headings

1 :
  1. Did it Leak

H2 Headings

14 :
  1. providing the South with quality plumbing services
  2. Welcome to Did it Leak
  3. Welcome to Did it Leak
  4. Home Maintenance Services London
  5. Burst Pipes
  6. Our Other Domestic & Commercial Services
  7. Did it Leak Plumbers
  8. Recommended Cleaning Businesses in London & Surrey
  9. Plumbing and Drainage Systems
  10. Central Heating
  11. Top Tips from the Plumbers
  12. 247 Plumbers
  13. Leaking Taps
  14. Posts navigation

H3 Headings

3 :
  1. Like & Follow
  2. Recent Posts
  3. Categories

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

10 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-89049025-1

Links - Internal

65:

Links - Internal (nofollow)

0:

Links - Outbound

56:

Links - Outbound (nofollow)

50:

Keyword Cloud for Diditleak.co.uk

therecentral heatingcentraltipsdidplumbinghouseholdinsurancemaintenanceusdecember 8did it leakcommercial domesticburst pipesoffplumbing serviceslondoncontact0plumberplumbers postedposted on decemberyoutheydiditleakpostedpipesdomesticpipeifhelphomeplumbers1postsdecembermainhavesouthrepairsheatingleaking tapsemergencytapsinstallationsburstservicesamphellipsystemsleakcontact usotherthey haverecommendedproperty2ourboilerleakingcleaningcommercialsurrey2018 diditleakpostedif youpostedhome maintenanceyearswecancold038systemyourwater

Who hosts Diditleak.co.uk?

Diditleak.co.uk Hosting Provider Information

Hosted IP Address:51.77.116.174
Hosted Hostname:ns3133907.ip-51-77-116.eu
Service Provider:OVH SAS
Hosted Country:FranceFR
Location Latitude:48.8582
Location Longitude:2.3387
Webserver Software:Apache/2.4.41 (Ubuntu)

Is "OVH SAS" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.2088%
Unknown
5.0138%
AS-26496-GO-DADDY-COM-LLC
4.3256%
NAMECHEAP-NET
3.6268%
AMAZON-AES
2.7254%
GoDaddy.com, LLC
2.4825%
UNIFIEDLAYER-AS-1
2.3319%
Fara Negar Pardaz Khuzestan
1.9947%
CONFLUENCE-NETWORK-INC
1.7092%
1&1 Internet AG
1.6708%
OVH SAS
1.3451%

HTTP Header Analysis for Diditleak.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 30 Mar 2021 03:54:41 GMT
Server: Apache/2.4.41 (Ubuntu)
Link:; rel="https://api.w.org/"
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 10648
Content-Type: text/html; charset=UTF-8

Diditleak.co.uk Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Diditleak.co.uk?


Domain Registration (WhoIs) information for Diditleak.co.uk

 Domain name:
diditleak.co.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 20-Apr-2017

Registrar:
Matthew Colley t/a HFM - Hosting for Me [Tag = HOSTINGFORME]
URL: http://www.hostingforme.co.uk

Relevant dates:
Registered on: 26-Dec-2012
Expiry date: 26-Dec-2020
Last updated: 06-Dec-2018

Registration status:
Registered until expiry date.

Name servers:
ovh.mammoth.me.uk 5.196.133.182
ovh1.mammoth.me.uk 5.196.133.183

WHOIS lookup made at 21:27:06 09-May-2020

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2020.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Websites with Similar Names

Didit-arlekinos.com
https://christosoiko.wixsite.com/bobolou
Didit-highend.com
Just a moment...
Didit.academy
didit.academy - Registered at Namecheap.com
Didit.co.il
DiDiT.co.il - ????? ???????
Didit.com
Long Island's Top Advertising & Marketing Agency | Nassau, Suffolk & NYC
Didit.fail
503 Service Temporarily Unavailable

Recently Updated Websites

Immofacts.ch (10 seconds ago.)Botanicadigital.com (10 seconds ago.)Akrasprint.com (11 seconds ago.)Duilawofficenewjersey.com (11 seconds ago.)Stellaschafer.com (13 seconds ago.)Yibo9871.com (13 seconds ago.)Perevozka-bolnih.ru (15 seconds ago.)Kastamonudangelsin.com (21 seconds ago.)Peaksixty.com (23 seconds ago.)Sparkofthesundesigns.com (24 seconds ago.)Semiramisrestaurant.com (25 seconds ago.)Thewritingorbit.org (29 seconds ago.)Azzithomas.com (29 seconds ago.)Hoshi-comode.com (31 seconds ago.)Nordei.com (34 seconds ago.)Mellofamilylightshow.com (35 seconds ago.)Godot3d.com (38 seconds ago.)Kansasvirtualoffice.com (40 seconds ago.)K86v.icu (41 seconds ago.)Kmv-stroitel.ru (42 seconds ago.)Fujinaija.com (44 seconds ago.)Microcad.co (44 seconds ago.)Dwilsonmusic.com (47 seconds ago.)Joaquimcasacuberta.cat (48 seconds ago.)Bambi-craft.com (48 seconds ago.)Airshowbase.hu (50 seconds ago.)Jobonlinee.com (53 seconds ago.)Zoyapro.com (57 seconds ago.)Hondabitcoin.com (58 seconds ago.)Orlandostrong.net (58 seconds ago.)

Recently Searched Keywords

mandala thi lun (1 second ago.)015c9e 100 (1 second ago.)personenbezogenen daten erfolgt (1 second ago.)metselaars (2 seconds ago.)mandala thi (2 seconds ago.)mai hoa (sbs radio) (4 seconds ago.)cloud content (8 seconds ago.)psihosted (11 seconds ago.)not currently (14 seconds ago.)39px 100 left (14 seconds ago.)2019 25 (14 seconds ago.)c amp (16 seconds ago.)провід мідний ппв (17 seconds ago.)вибір перетину кабелю (18 seconds ago.)силові кабеля (19 seconds ago.)narayana verlag robert franz produkte (19 seconds ago.)dla partnerã³w (20 seconds ago.)swap (20 seconds ago.)ezgi mola, başörtülü akademisyenin saldırıya uğramasına öfke kustu: it gibi öğreneceksiniz (21 seconds ago.)trường cao đẳng y dược sài gòn (21 seconds ago.)kabel ac 1 pk (22 seconds ago.)іноземні аналоги кабелю (23 seconds ago.)island biodiversity (24 seconds ago.)h l (25 seconds ago.)pk kabelfarbe (25 seconds ago.)bandenwissel (25 seconds ago.)перевідна таблиця неізольованого проводу а (26 seconds ago.)sunning (26 seconds ago.)sunnies specs (27 seconds ago.)рекомендовані норми товщини ізоляції (27 seconds ago.)