Harp Substitute

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2021-04-19
Domain label
dindeen
Domain extension
club
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Dindeen.club registered?
A: Dindeen.club was registered 2 months, 2 hours, 21 minutes, 17 seconds ago on Monday, April 19, 2021.
Q: When was the WHOIS for Dindeen.club last updated?
A: The WHOIS entry was last updated 2 months, 2 hours, 21 minutes, 17 seconds ago on Monday, April 19, 2021.
Q: What are Dindeen.club's nameservers?
A: DNS for Dindeen.club is provided by the following nameservers:
  • ns06.domaincontrol.com
  • ns05.domaincontrol.com
Q: Who is the registrar for the Dindeen.club domain?
A: The domain has been registered at .
Q: What is the traffic rank for Dindeen.club?
A: Dindeen.club has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Dindeen.club each day?
A: Dindeen.club receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Dindeen.club resolve to?
A: Dindeen.club resolves to the IPv4 address 95.215.210.10.
Q: In what country are Dindeen.club servers located in?
A: Dindeen.club has servers located in the Russia.
Q: What webserver software does Dindeen.club use?
A: Dindeen.club is powered by CloudFlare webserver.
Q: Who hosts Dindeen.club?
A: Dindeen.club is hosted by New information technologies Ltd in Udmurtiya Republic, Izhevsk, Russia, 426000.
Q: How much is Dindeen.club worth?
A: Dindeen.club has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Dindeen.club Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Dindeen.club Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Dindeen.club

H1 Headings

1 :
  1. UPDATE:

H2 Headings

11 :
  1. Save up to $3,252 ($271 per month) off your mortgage - Check if you qualify for refinance offers.*
  2. Credit Score
  3. Property Value
  4. Loan Amount
  5. Cash Out?
  6. Are you currently in an FHA loan?
  7. Are you a veteran or active military?
  8. Your Address
  9. Final Step
  10. Please complete to get your free rate quote
  11. Rate Disclosure

H3 Headings

4 :
  1. Terms of Use
  2. Privacy Policy
  3. Mortgage Rates as low as 3.125% (3.851% APR) – Disclosure current as of 13-Sep-19.
  4. Disclosure Assumptions

H4 Headings

34 :
  1. Scroll down for more matches!
  2. 1. USER AGREEMENT.
  3. 2. SERVICES.
  4. 3. CHANGES TO TERMS AND CONDITIONS AND POLICIES.
  5. 4. REJECTION, TERMINATION AND CANCELLATION.
  6. 5. PROHIBITED USER CONDUCT.
  7. 6. MARKETING MATERIALS.
  8. 7. THIRD PARTY CONTENT/PROMOTIONS, THIRD PARTY PRODUCTS, AND THIRD PARTY WEBSITE ACTIVITIES.
  9. 8. RELATIONSHIP WITH MARKETING PROVIDERS.
  10. 9. LINKED WEBSITES.
  11. 10. INTELLECTUAL PROPERTY RIGHTS.
  12. 11. DISCLAIMER OF WARRANTIES.
  13. 12. LIMITATION OF LIABILITY.
  14. 13. EXCLUSIONS AND LIMITATIONS.
  15. 14. MONITORING WEBSITE USAGE.
  16. 15. INDEMNITY.
  17. 16. RELEASE.
  18. 17. DEALINGS WITH THIRD PARTIES.
  19. 18. DISPUTE RESOLUTION.
  20. 19. WAIVER AND SEVERABILITY OF TERMS.
  21. 20. ENTIRE AGREEMENT.
  22. 21. STATUTE OF LIMITATIONS.
  23. PLEASE PRINT AND RETAIN A COPY OF THIS AGREEMENT FOR YOUR RECORDS.
  24. Last Updated January 3, 2020
  25. Information We Collect
  26. Cookies, Web Beacons, and JavaScript
  27. How We Use Information Collected.
  28. We will share your personal information with third parties in the following ways:
  29. Third Party Collection and Use of Information.
  30. Information Security and Retention
  31. Changes to Privacy Policy
  32. GDPR and CASL Compliance
  33. California Consumers’ Privacy Rights
  34. CONTACT US

H5 Headings

1 :
  1. (To pay off credit card bills, home improvement project, etc)

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

13 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Dindeen.club

changescollectionpleaseuserwishaffiliatedbeforebaseduse our websiteconductwarrant or guaranteeunder the ccpaharpsubstitutecomdeletionmayvariablebeaconswithout limitationoffermonicaanalyzepartners agents affiliatescommercialtelemarketingprivacyinitialthirdwellpoliciestimedealingscookiesnot actingrespondrecordsproducts or servicesproducts youagreement shallsanta monicaour servicesremarketingnothinglos angelesinformation pleasemay receiveproducts and servicesvendorssellrelatedtrackvarbut notwebsite wesocial mediadoes notourobligationsmergerbackemploymentinformation with thirdratespersonany wayour websiteparticularcreditcanactingsectionaddress telephone numbersaleserviceinterestsprofessionalcosts20minformation includingextentsuitetheir servicesyou maybehalfincluding butalso usearbitrationmonthsyou alsomeet youragree that weyour visitexerciseliabilityservices providedinformation about youcaliforniaableagree that companypracticeshereininternet protocolservices and productsservicesthese termsdescribedservices weindividualapragentsmessagesintellectual propertyuser informationscreenssomewhethernamesnumbercommunicationspromotion third partyelseeuropean unionyespageinterest ratelicenseangeles caagreednonpersonal informationnot be responsibleuntilwhom3identifierselectmortgage refinancingclaimpartnerscookies webidentificationservice or productprovisionsincluding withoutyou usenotoneyou doreceivedchangeanonymouspersonalbetweenwe have collectedwe may alsoca 900694109eitheronetrustinformation nopostalyou also givecompanysubmittinggiving yourknowgooglewe may usewebsite mayinformation whichunionmonica blvdprovidingcontactunderstand and agreeamountinformation mayfulfillvalueinformation describedtrackingblvd suiteprotocolcollectfurtherpatternsother4applicablesetaggregatedregardingprotectfunctionlistediiiresponsibleproducts which maystatuscontact youcare 8605participating service providerslenderdata noccpahoweverlimitedwhichcourtcompanysangelesservices or productsdamageuponofficerswe sharedoesaddressesobtainprovisioneuropeanoptpartyagents affiliates licensorsdirectlyindustrymaterialsfailurewe gatherprioravailabilityguaranteemay alsoenterentryhomecalledsend you periodicyour personalcare 8605 santalossconstituteany dataif weexcept as otherwiseshall constitutesubsidiariesthereofbusiness8605 santaindirectlyeffectupcredit cardaccordancepropertyhistoryendorsementinterest to youmailhereyour requestposted privacysuch informationparty promotion thirdrequiredcookieitsmemberwebsite activityintobelowiinotesendshare your personalinformation we gatherratefillinformation weproductsfacilitateparticipatingmadeprovidedbasisdocumentreadyfunctionproprietaryreviewstorewrittenpromotionsparticipating service providervisitorsmay notunderstandrequest youwarrantfollowing categoriesoffersthird party productsnonpersonalpromotion thirdrequirementsassistsubmittedif youyou furthercodepurchasethemparticipatepersonal information describedrefinancingprovide youfinancial informationyour personal informationperson or entitylicensorsrequestsset forthfeereceiveinternetrightunion memberimprovementwebnumbersnotifyinformation providedpermissionyou agreeindividualsfinancialsend youwe havepersonal information providedusedrequestwithout noticeweany particularneedsallow usparticipating providersaccountperadvertisingattorneysservershave requestedthird partiespagesidentifiersprovidetrueincluding without limitationactionmeansproviderswebsite or anyusingany otherdifferentyouaddressthrough the websitesanta monica blvdweb beaconswe doariseforthperiodcompleteelectroniccookies web beaconsmortgageyourservice providerspreferencesofferedwebsite includingwe may receiveaffiliates licensorsmeetgatheryou youalso givegoogle analyticspromotionagents affiliatespurposeresponsible for anythird party websiteusing this websitepolicycontractactionssolelyfeaturessone of ourloscausereasonablewe useany claimservices offeredcertaininability to usepartiespastportionyour browserpartharpsubstitutecom attnmay requestmorepermission to sendincluding but nottelephone numbershare your informationinformationrefinancewe have nosubsidiaries partners agentsangeles ca 900694109tradesubmit a requestassignsconnectionbeenany websiteplease selectdirectattn customer caresocial2unitedsecure1operatingeuropean union memberdistrictany persontypeproducts whichany portionworkanymarketingyou periodiconlysimilaruse the websiteemail addressdisputeownthrough our websiteoperating systemmustmay includeactivityconsumerintendedadditionalsuccessors and assignsknownyour emailcompliancecategoriesagreementparty websitegetpersonal informationinformation may includewebsite or websitecollecteddatathird partyrespectperformneedsoldremoveloanassociationeaffiliateslegal processpartners agentsthesewebsites youwhich youcharacteristicseventyou periodic updatesdoubleclickperiodic updatesmakearisingprocesssecurityany and allotherwiseyearplease noteidentityparticular servicecopylinkservices youimproveblvddescriptionreadmodifysuccessorsphysicalacceptany informationhave collectedentitycontainedprivacy policytheirhave beenwebsitesorderparty promotionparty productsdemographic informationcompany is notcontentdo notacknowledgeauthorizedlegaltrademarkswhom youpersonsinsurancerequestedparticular service providerwebsitetransferlinksalsodiscretionuseattndamageswe mayfirstformsall othernamefeesdatealterationwhich maycomputergive uswe will shareattn customerchoosepermittedcompaniesgivingassetsonlinedirectorsrelationshipthanliablecollect informationactivitiessale of personalsoleinterestwebsite youaccessyou haveinformation collectedcompany shalldttodatestringsplitnot controlwebsite you agreeshouldservice providerrespectiveprecautionsandorsame8605 santa monicafieldemployeesposted privacy policyeachfullygivecanadiantheir respectivewe are notdemographicfollowingparty cookiesuse ourequipmentcurrentlyyour email addresswaiveincreaseforegoingthirdparty providerlocationconsentparty vendorsnoticeplusus permissionallclaimsshall notany third partysubjectcallcitizensdirect mailmarksfunctionswe share yourconsumersnetworktakesole discretionprohibitedallowlinked websitescaresystemmobileshallsoftwareresultparticipating servicecontinue backunderinformation is informationsuch as throughnot limitedsorightscustomer care 8605agemedialinkedoverbutemailyour informationname addressavailablewe collectprivacy rightsyes noyou may notyou have requestedspecificremedyalso give usreleaseshareevenperiodicyou are prohibitedagreereturnposteddisplaypersonal and nonpersonalboundtheyshall haveeducationproductyou visitincludesdospecificallythird party productaddress telephonegive us permissionlawintellectualcategories of personalduringincludingexpresslywe providethereviamaximumsuch thirdretainnot be usedwithinservices you haverefinance companydisclosurepurposescontrolcontinuelawshavebrokerthirdpartytelephonefederalactualprovidernot usetechnologythird party vendorscardcompany shall notsantamortgage refinance companyjavascriptagent or brokercustomer carefalseoffwebsite contentfulladwordsname address telephoneaboveentitiesprovide to uswayoperateformmortgage refinanceinabilityshare yourafterusersharpsubstitutecom attn customerinformation regardinganalysisdiscloseupdatesdisclosedanalyticsautomaticallyexperienceparticipationother thanterms and conditionsthrough ourindependentparty website activitybrowseroutcustomerparty productwe do notthoseproduct or thirdyearsalthoughagentadvertisersany particular servicebusiness purposeyou do notifoptoutbehavioralmonth900694109governmentunited statesstatesmonica blvd suiteproduct or servicereferencenobut not limitedtechnologies0may useyou directlyprotecteddo not controlcaushave nosubdivisionsubmitincludeupdates of servicesthroughyou understandlistexceptsuchgendervisitpaidstateuse the informationthird party promotionip56withouttermstransmissionuniquesubsidiaries partnerslimitationregistrationsiteveteranyour usepaymentemail messagesliable for anyinformation younot responsibleatsrrelatingfunctionalityany thirdyou provideerrortechnicalapplicationwarrantiesconditions

Longtail Keyword Density for Dindeen.club

KeywordsOccurences
products or services15
terms and conditions14
we do not13
we are not10
information about you9
share your personal8
agree that we7
understand and agree7
products and services7
but not limited7
including but not6
use the website6
third party website6
through the website6
your personal information6
you are prohibited6
participating service provider5
information is information5
agree that company5
services and products5
any and all5
interest to you5
categories of personal5
third party promotion5
third party product5
party website activity5
personal and non-personal4
cookies web beacons4
particular service provider4
we have no4
through our website4
you have requested4
responsible for any4
except as otherwise4
your email address4
any third party4
information with third4
product or service4
provide to us4
subsidiaries partners agents3
partners agents affiliates3
agents affiliates licensors3
successors and assigns3
website or website3
company is not3
harpsubstitutecom attn customer3
attn customer care3
share your information3
customer care 86053
third party vendors3
sale of personal3
such as through3
personal information described3
we share your3
do not control3
information we gather3
use the information3
we may use3
we have collected3
care 8605 santa3
product or third3
information may include3
use our website3
personal information provided3
angeles ca 90069-41093
monica blvd suite3
santa monica blvd3
8605 santa monica3
inability to use3
warrant or guarantee3
promotion third party3
you do not3
also give us3
you also give3
not be responsible3
company shall not3
one of our3
using this website3
you may not3
posted privacy policy3
permission to send3
we may also3
website you agree3
european union member3
any particular service3
services you have3
services or products3
service or product3
give us permission3
send you periodic3
party promotion third3
we may receive3
third party products3
including without limitation3
person or entity3
website or any3
not be used3
liable for any3
participating service providers3
agent or broker3
you periodic updates3
mortgage refinance company3
address telephone number3
name address telephone3
we will share3
submit a request3
products which may3
updates of services3
under the ccpa3
third party43
our website39
personal information37
third parties30
do not24
you may20
you agree16
privacy policy16
information we15
website content14
service provider14
we may14
we do13
any other13
service providers13
you have12
if you12
we have12
we use11
your information11
share your11
you understand11
your personal11
may not10
linked websites10
your use10
any information9
provide you9
website you9
web beacons9
have no8
participating service8
email address8
not limited8
interest rate8
particular service7
these terms7
information collected7
we collect7
services you7
information provided7
non-personal information7
shall not7
continue back7
but not7
party website6
your browser6
whom you6
without limitation6
google analytics6
may include6
not responsible6
contact you6
information you6
services provided6
including but6
united states6
telephone number6
which may6
does not6
los angeles5
such information5
you visit5
services we5
any third5
website activity5
which you5
email messages5
any way5
please select5
party product5
participating providers5
party promotion5
use our4
intellectual property4
mortgage refinancing4
information which4
information may4
collect information4
website including4
agreement shall4
please note4
their respective4
address telephone4
website we4
website may4
have been4
your email4
through our4
we share4
set forth4
sole discretion4
have requested4
their services4
if we4
you also4
information no4
credit card4
send you4
cookies web4
business purpose4
without notice4
social media4
your request4
may use4
attn customer3
information including3
we gather3
party cookies3
not control3
harpsubstitutecom attn3
data no3
information described3
following categories3
your visit3
legal process3
customer care3
monica blvd3
care 86053
8605 santa3
santa monica3
also use3
blvd suite3
allow us3
angeles ca3
ca 90069-41093
party vendors3
information please3
have collected3
internet protocol3
yes no3
demographic information3
operating system3
any claim3
user information3
affiliates licensors3
third-party provider3
you periodic3
us permission3
give us3
also give3
company shall3
information regarding3
products you3
you further3
direct mail3
shall constitute3
such third3
products which3
giving your3
our services3
you do3
you use3
posted privacy3
may also3
meet your3
union member3
european union3
any particular3
all other3
periodic updates3
name address3
agents affiliates3
you provide3
partners agents3
subsidiaries partners3
other than3
any portion3
websites you3
promotion third3
shall have3
services offered3
party products3
may request3
including without3
any website3
financial information3
privacy rights3
not use3
any data3
any person3
we provide3
may receive3
not acting3
you directly3
refinance company3
mortgage refinance3
request you3
you you3
you211
information180
website136
any129
we124
your103
not91
may85
our82
use81
third73
services60
other57
party54
service51
personal48
company47
such47
have40
which39
products39
us37
parties35
agree33
providers30
email30
through29
no29
including28
their27
if27
content27
provided26
do26
provide26
terms26
provider25
all24
cookies24
these24
privacy24
please24
agreement24
data22
websites21
request20
consumers20
policy19
rights19
its19
conditions18
address18
shall18
number18
var18
collected18
collect17
california17
without15
share15
interest15
mortgage14
right14
rate14
google14
participating14
function13
under13
otherwise13
web13
advertising13
product13
arbitration13
can13
also12
linked12
understand12
access12
andor12
using12
process11
particular11
responsible11
used11
browser11
directly11
internet11
out11
contact11
telephone11
business11
limited11
connection10
credit10
loan10
include10
whom10
activity10
property10
law10
opt-out10
whether10
user10
only9
users9
type9
available9
year9
receive9
subject9
network9
action9
purpose9
beacons9
state9
sole9
marketing9
make9
following9
time9
prohibited9
javascript9
way8
analytics8
categories8
partners8
visit8
but8
control8
name8
limitation8
legal8
consumer8
court8
continue8
requested8
back8
purposes7
contained7
mail7
after7
technology7
set7
non-personal7
loss7
card7
individual7
purchase7
functionality7
described7
either7
damages7
warranties7
protect7
they7
states7
accept7
social7
does7
software7
form7
computer7
same6
includes6
links6
records6
features6
media6
required6
security6
characteristics6
agents6
maximum6
section6
disclose6
cookie6
discretion6
vendors6
solely6
agent6
respond6
retain6
customer6
track6
relationship6
ii6
so6
age6
history6
messages6
arising6
dealings6
direct6
more6
means6
yes6
providing6
registration6
notice6
citizens6
ccpa6
financial6
payment6
page6
secure6
them6
offers6
angeles6
affiliates6
been6
united6
activities5
increase5
give5
status5
each5
federal5
site5
obtain5
analysis5
past5
insurance5
fulfill5
first5
display5
based5
except5
electronic5
application5
costs5
liable5
refinancing5
gather5
disclosed5
liability5
promotion5
rates5
employment5
basis5
servers5
return5
copy5
submit5
harpsubstitutecom5
apr5
consent5
transfer5
code5
person5
permitted5
05
home5
claim5
provision5
companies5
identifiers5
allow5
different5
compliance5
warrant5
behavioral5
change5
physical5
accordance5
regarding5
made5
within5
herein5
one5
respective5
error5
technical5
value5
tracking5
permission5
send5
select5
below5
result5
specifically5
collection5
disclosure5
los5
know5
before5
expressly5
education4
refinance4
month4
promotions4
licensors4
district4
off4
portion4
prior4
related4
than4
advertisers4
intellectual4
20m4
practices4
exercise4
over4
mobile4
additional4
certain4
persons4
complete4
demographic4
analyze4
written4
failure4
choose4
take4
own4
participate4
should4
sale4
commercial4
behalf4
submitted4
date4
periodic4
laws4
applicable4
provisions4
entities4
system4
review4
requests4
individuals4
bound4
years4
initial4
further4
posted4
effect4
forth4
wish4
release4
constitute4
upon4
third-party4
trade4
atsr4
telemarketing4
employees4
materials4
event4
improve4
notify4
listed4
link4
perform4
damage4
sell4
sold4
well4
entity4
conduct4
claims4
those4
policies4
changes4
14
gender4
offer4
broker4
note4
online4
fees4
per4
lender4
patterns4
guarantee4
store3
unique3
90069-41093
during3
suite3
numbers3
ca3
up3
industry3
identification3
above3
precautions3
protected3
period3
until3
identifier3
subdivision3
e3
identity3
assets3
work3
government3
here3
onetrust3
variable3
documentreadyfunction3
fill3
dttodatestringsplit3
field3
license3
merger3
interests3
technologies3
ip3
location3
operating3
anonymous3
protocol3
addresses3
pages3
actual3
specific3
monica3
although3
preferences3
need3
adwords3
remarketing3
doubleclick3
description3
functions3
visitors3
blvd3
fee3
santa3
true3
fully3
automatically3
actions3
entry3
into3
order3
giving3
23
authorized3
remedy3
enter3
foregoing3
reference3
false3
iii3
aggregated3
able3
companys3
updates3
communications3
full3
contract3
assist3
acting3
33
read3
nothing3
experience3
get3
43
amount3
improvement3
currently3
veteran3
acknowledge3
via3
even3
call3
list3
opt3
must3
there3
months3
facilitate3
paid3
meet3
needs3
forms3
canadian3
european3
union3
member3
submitting3
requirements3
arise3
53
extent3
transmission3
alteration3
account3
subsidiaries3
successors3
assigns3
else3
63
officers3
directors3
some3
operate3
received3
reasonable3
attorneys3
waive3
known3
dispute3
relating3
agreed3
called3
plus3
attn3
care3
deletion3
part3
professional3
inability3
cause3
independent3
proprietary3
intended3
equipment3
similar3
obligations3
modify3
postal3
offered3
participation3
affiliated3
screens3
trademarks3
marks3
names3
association3
endorsement3
respect3
however3
availability3
indirectly3
remove3
between3
thereof3
s3

Who hosts Dindeen.club?

Dindeen.club Hosting Provider Information

Hosted IP Address:95.215.210.10
Hosted Hostname:95.215.210.10
Service Provider:New information technologies Ltd
Hosted Country:RussiaRU
Location Latitude:56.8489
Location Longitude:53.2316
Webserver Software:CloudFlare

Is "New information technologies Ltd" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
New information technologies Ltd
0.0953%

HTTP Header Analysis for Dindeen.club

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 19 Apr 2021 06:40:57 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Tue, 13 Apr 2021 17:23:41 GMT
Vary: Accept-Encoding
CF-Cache-Status: DYNAMIC
cf-request-id: 098a756f2b0000f3e39e15a000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Report-To: {"group":"cf-nel","max_age":604800,"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?s=mSjBK/LyiCXXc+xaBgCjw9DDUlneyEIf8RzAp2O61hvl0Rdy8nBDZlwQ6Y9HvLExkxwFkMCBWUHwrTyNfenI/YMkttbzIBOZ+ZZTEQGeBmRpJ2o="}]}
NEL: {"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 642424f84fe9f3e3-LHR
Content-Encoding: gzip
alt-svc: h3-27=":443"; ma=86400, h3-28=":443"; ma=86400, h3-29=":443"; ma=86400

Dindeen.club Domain Nameserver Information

HostIP AddressCountry
ns06.domaincontrol.com 173.201.70.3
ns05.domaincontrol.com 97.74.102.3


Need to find out who hosts Dindeen.club?


Domain Registration (WhoIs) information for Dindeen.club

 Domain Name: dindeen.club
Registry Domain ID: D828FCEA84450425A8ADC18C2F1732E9A-NSR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: whois.godaddy.com
Updated Date: 2020-09-15T09:01:24Z
Creation Date: 2020-09-10T09:01:18Z
Registry Expiry Date: 2021-09-10T09:01:18Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: Nextgen Web Solutions
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: Surrey
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: GB
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: ns05.domaincontrol.com
Name Server: ns06.domaincontrol.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-04-19T06:40:58Z

Websites with Similar Names

Dinde-de-noel.fr
Découvrez notre sélection de doudounes et de manteaux de dames, découvrez nos dernières tendances Hoodies et Pulls Molletonnés et découvrez que nous offrons des réductions sur les vêtements de nuit pour femmes à des réductions
Dinde.fr
La Volaille Française - Site Officiel
Dindebat.dk
Jubii Debat - Deltag i debatten på Danmarks største debat forum
Dindeefarm.com
Welcome dindeefarm.com - BlueHost.com
Dindeefarms.com
Welcome dindeefarms.com - BlueHost.com
Dindeen.club
Harp Substitute
Dindel.se
Eniro.se - Upptäck närheten.
Dinden.net
dinden.net

Recently Updated Websites

Recordingthemasters.net (4 seconds ago.)Dietrapid.com (6 seconds ago.)Crestoneinvestments.com (6 seconds ago.)Elite-center.com (6 seconds ago.)Muthas.app (7 seconds ago.)Tarouemon.com (7 seconds ago.)Plasticlovers.co.uk (8 seconds ago.)Giingdan.asia (12 seconds ago.)Dogtrainingchesapeake.com (12 seconds ago.)Kompetencekanalen.com (12 seconds ago.)Bagglebox.com (13 seconds ago.)Pppdesign.net (13 seconds ago.)Yy8631.com (14 seconds ago.)Ladaceskincare.com (14 seconds ago.)Rolf-benz.com (14 seconds ago.)Healthierbreathing.com (15 seconds ago.)Cye7.com (15 seconds ago.)Multibk.ru (16 seconds ago.)Shibuyamokei.com (16 seconds ago.)Domivse.ru (16 seconds ago.)Ggapparels.in (17 seconds ago.)Yennybroadie.com (17 seconds ago.)Worldwidesportsmatchup.com (18 seconds ago.)Earthgauge.ca (18 seconds ago.)Thebigmamablog.com (18 seconds ago.)Ton547.com (19 seconds ago.)Xango.net (20 seconds ago.)Aboutgroundcovers.com (20 seconds ago.)Fortheculture.agency (20 seconds ago.)Thethrifter.com (20 seconds ago.)

Recently Searched Keywords

رحیم صادقی دمنه، محمدرضا گل دوست، رضا ابراهیمی قلعه حسن (1 second ago.)7: submit a tip (2 seconds ago.)james chun (2 seconds ago.)крем пудра (4 seconds ago.)대한민국 인구 세계 순위 (5 seconds ago.)years developed stiffer (5 seconds ago.)curiosités (7 seconds ago.)thani (8 seconds ago.)карнизы, крепёжные системы и аксессуары (9 seconds ago.)ternala (10 seconds ago.)人力资源部是做什么的 (12 seconds ago.)download otf (offsite) (12 seconds ago.)how to apply (15 seconds ago.)avatar3932550601contentbordersolid 1px (15 seconds ago.)practce (15 seconds ago.)s8152my (17 seconds ago.)osbmgroup (17 seconds ago.)maison vauron dinner (17 seconds ago.)yryw (20 seconds ago.)meet you or meet with you (22 seconds ago.)clinical oncology training (24 seconds ago.)granola (24 seconds ago.)nhiều vi phạm tại dự án nhà tái định cư ở phước kiển (24 seconds ago.)swiper-container var (26 seconds ago.)alabai dog price (26 seconds ago.)uzaytv canli yayin (27 seconds ago.)reparaturen ohne groen (28 seconds ago.)unique hampers (31 seconds ago.)常用測量器具的使用注意... (31 seconds ago.)кроу анна (32 seconds ago.)