Discovery.co.za Website Analysis Summary
Low trust score |
Medical Aid, Bank, Insurance, Invest & Vitality - Discovery
| Rank | 13,146 |
| Rating | F |
| Trust Score | Low Trust Score |
| Estimated worth | $1,157,040 |
| Estimated daily income | $1,607 |
| Estimated monthly income | $48,880 |
| Backlinks | 0 |
Discovery.co.za has a Low Trust Score, and a Statvoo Rank of F.
Discovery.co.za is hosted by DHN-BGP-AS2002 in Gauteng, Sandton, South Africa, 2191.
Discovery.co.za has an IP Address of 196.6.184.100 and a hostname of 196.6.184.100.
The domain discovery.co.za was registered 201 decades 9 years 4 months ago by UniForum Association, it was last modified 201 decades 9 years 4 months ago and currently is set to expire 201 decades 9 years 4 months ago.
It is the world's 13,146 most popular site among over 300 million websites.
Discovery.co.za has a total of 0 backlinks.
Discovery.co.za gets approximately 133,881 unique visitors a day and 803,286 pageviews per day.
Discovery.co.za has an estimated worth of $1,157,040.
An average daily income of approximately $1,607, which is wroughly $48,880 per month.
Whois information for discovery.co.za
Full Whois Lookup for Discovery.co.za Whois Lookup
simple CO.ZA whois server
The CO.ZA simple whois server
© Copyright ZACR 1995-2017
Use of this facility subject to theterms of site usage
Your query has generated the following reply:-
Search on discovery (.co.za)
Match: One
Domain: discovery.co.za
Accounting info....
Date |Type| Cost |Invoices are E-Mail to....|Paid Date |ICnt| TrkNo |Billing Info
Flashing RED indicates that payment has not been received - please
confirm with the ZACR accounting department, Login to show email
should this
not be according to your records. You have been sent 0 invoices/statements.
0a. lastupdate :
0b. emailsource :
0c. emailposted :
0d. emailsubject :
0g. historycount :
0h. invoiceno :
0i. contracttype :
0j. rcsversion :
1a. domain : discovery.co.za
1b. action :
1c. Registrar : MarkMonitor
2a. registrant : Discovery Limited
2b. registrantpostaladdress: 155 West Street, Sandton, , Johannesburg, Gauteng, 2146, ZA
2c. registrantstreetaddress:
2d. amount :
2e. paymenttype :
2f. billingaccount :
2g. billingemail :
2i. invoiceaddress :
2j. registrantphone : +27.115294357
2k. registrantfax : +27.115294357
2l. registrantemail : Login to show email
vat :
3b. cname :
3c. cnamesub1 :
3d. cnamesub2 :
3e. creationdate : 1996/08/20 00:00:00
4a. admin :
4b. admintitle :
4c. admincompany :
4d. adminpostaladdr :
4e. adminphone :
4f. adminfax :
4g. adminemail :
4h. adminnic :
5a. tec :
5b. tectitle :
5c. teccompany :
5d. tecpostaladdr :
5e. tecphone :
5f. tecfax :
5g. tecemail :
5h. tecnic :
6a. primnsfqdn : ns1.discovery.co.za
6b. primnsip : 185.114.38.188
6c. primnsipv6 :
6e. secns1fqdn : ns2.discovery.co.za
6f. secns1ip : 107.6.4.90
6g. secns1ipv6 :
6i. secns2fqdn : ns3.discovery.co.za
6j. secns2ip : 5.152.177.58
6k. secns2ipv6 :
6m. secns3fqdn :
6n. secns3ip :
6o. secns3ipv6 :
6q. secns4fqdn :
6r. secns4ip :
6s. secns4ipv6 :
8a. netblock1start :
8b. netblock1end :
8c. netblock2start :
8d. netblock2end :
8e. netblock3start :
8f. netblock3end :
9a. description1 :
9b. description2 :
9c. description3 :
9d. description4 :
9e. description5 :
9f. description6 :
Next Query - Domain name
.co.za
Please refer to the CO.ZA contact details should you have any problems
Who hosts Discovery.co.za?
Discovery.co.za Web Server Information
| Hosted IP Address: | 196.6.184.100 |
| Hosted Hostname: | 196.6.184.100 |
| Service Provider: | DHN-BGP-AS2002 |
| Hosted Country: |  ZA |
| Location Latitude: | -26.0545 |
| Location Longitude: | 28.0589 |
| Webserver Software: | Not Applicable |
HTTP Header Analysis for Discovery.co.za
| Http-Version: | 1.1 |
| Status-Code: | 200 |
| Status: | 200 OK |
| Date: | Fri, 12 Jun 2015 09:05:49 GMT |
| Server: | Apache/2.2.3 (Red Hat) |
| Content-Language: | en-ZA |
| X-Powered-By: | Servlet/3.0 JSP/2.2 |
| X-Frame-Options: | SAMEORIGIN |
| Vary: | Accept-Encoding |
| Content-Encoding: | gzip |
| Content-Type: | text/html; charset=ISO-8859-1 |
| X-dynaTrace-JS-Agent: | true |
| Transfer-Encoding: | chunked |
Need to find out who hosts Discovery.co.za?
Discovery.co.za Free SEO Report
Website Inpage Analysis for Discovery.co.za
| H1 Headings: | 0 | ||
| H2 Headings: | 0 | ||
| H3 Headings: | 2 | Your session will expire in 60 seconds.
To secure your account you have been logged out | |
| H4 Headings: | 6 | Earn up to 5 000 Discovery Miles with the Discovery Integrator Get primary healthcare cover for employees in your home from R249 per month We’ll cover their education if anything happens to you Get up to 24 months of extra contributions allocated upfront Make children's dreams come true with MoveToGive this festive season. Listen to our Discover Healthier Podcast Show | |
| H5 Headings: | 0 | ||
| H6 Headings: | 4 | About us Contact us Join Discovery Connect with us | |
| Total IFRAMEs: | 6 | ||
| Total Images: | 8 | ||
| Google Adsense: | Not Applicable | ||
| Google Analytics: | Not Applicable |
Keyword Cloud for Discovery.co.za
password trouble logging0860 99specialfeesourbenefitsyourif usernamefieldgeneral meetingselectedmeganavidjssearchtriggerelementiddiscovery healthususernamefield usernamefieldfocus ifdocumentgetelementbyidmainsearchquery ifidinsurance life insuranceonline accounttopicsquote getexdaysspecial general meetinglife planmanagesitejsloginbtn varyouquerysundays3meetingif targetid jssearchtriggerforgot usernametruetrendingif typeoffamilyif targetid jsloginbtnonlinefriday 0700your familyusernamefield documentgetelementbyidusername iffrequently asked questionspassword troublemeganavid2017 specialyou and yourno documentsessionasked questionsloggingfunctionnavigationcontainerinnerinnerhtmlvitalityaskedforgotcontactcall 0860insurance lifepublic holidaystypeofdocumentgetelementbyidusername if usernamefield2017 special generalcanmanage yourjoininvestmentsplanonline account registerjsmobilenavtriggere5noif0860 99 88username password logdetailsstore call 0860discovery store calltargetid jssearchtrigger varlogging in needtargetid jsmobilenavtriggerdiscoverytrouble loggingusernamefieldfocus ifneedelserewardif targetidtargetid jsloginbtnviewclosemeganavnavigationcontainerholidaysoffersregisterschemejssearchtrigger varif usernamefield usernamefieldfocususernamefieldfunction enullcallifhasclassmobilenavtriggeraidsundays and publiclog in forgothome insuranceusernamefieldfocus if targetidnbsp nbsp getcarelementlog in usernamedocumentgetelementbyidmainsearchquerytargetidcar insurancegap coverfalsecovercredit cardeltargetid jsloginbtn vardocumentgetelementbyidusername ifpartnersjoin todayneed an onlineprofessionalsget uptermsbrowserquestionsclose0800today trending topicsrewardsfridayfrequently askedpublicfinancialgapcall 0860 99backjoin today trendingusernamefieldfocusmonday to fridaytrue ifbusinessusername password0nowusernamefield documentgetelementbyidusernameinsurance quoteyour lifemainsearchqueryfield99 88 772nbsp getreturnmobilenavtriggerclasslistremoveisactivehealthnewinsurance4storelognbsp nbsphealthcare professionalsjsloginbtn var usernamefieldmedicalreturn falselife insurancenavigationcontainerinnernbsp99 88mondayquestions discoverydiscovery health medicaljsloginbtnpasswordhomenbsp nbsp nbspvar usernamefield88 77documentundefinedvarmedical schemegetifhasclassmobilenavtrigger isactiveupusername and password0860generalusernamefield usernamefieldfocusasked questions discoveryreward partnershealth medicalaccount registerquotediscovery storelifeproductsisactiveyour life planmedical aidaccountusernametargetid jssearchtriggercardstore callquote why1closemeganavnavigationcontainer navigationcontainerinnervar usernamefield documentgetelementbyidusernamespecial generaltodaydocumentgetelementbyidusernamequestions discovery storecredittoday trendingwhytrending topicsconditionsiframe0700health medical schemepassword logid returnhealthcarefrequentlytrouble
Longtail Keyword Density for Discovery.co.za
| Keywords | Occurences |
|---|---|
| store call 0860 | 7 |
| discovery store call | 7 |
| join today trending | 6 |
| today trending topics | 6 |
| nbsp nbsp nbsp | 6 |
| monday to friday | 5 |
| nbsp nbsp get | 4 |
| you and your | 4 |
| frequently asked questions | 4 |
| log in forgot | 4 |
| if usernamefield usernamefieldfocus | 3 |
| usernamefield usernamefieldfocus if | 3 |
| targetid js-search-trigger var | 3 |
| if targetid js-search-trigger | 3 |
| usernamefieldfocus if targetid | 3 |
| 99 88 77 | 3 |
| asked questions discovery | 3 |
| questions discovery store | 3 |
| sundays and public | 3 |
| documentgetelementbyidusername if usernamefield | 3 |
| 0860 99 88 | 3 |
| call 0860 99 | 3 |
| js-login-btn var usernamefield | 3 |
| need an online | 3 |
| online account register | 3 |
| insurance life insurance | 3 |
| logging in need | 3 |
| password trouble logging | 3 |
| username password log | 3 |
| username and password | 3 |
| your life plan | 3 |
| 2017 special general | 3 |
| targetid js-login-btn var | 3 |
| log in username | 3 |
| var usernamefield documentgetelementbyidusername | 3 |
| if targetid js-login-btn | 3 |
| health medical scheme | 3 |
| special general meeting | 3 |
| discovery health medical | 3 |
| usernamefield documentgetelementbyidusername if | 3 |
| life insurance | 12 |
| nbsp nbsp | 11 |
| discovery store | 10 |
| call 0860 | 9 |
| if targetid | 8 |
| credit card | 8 |
| join today | 7 |
| store call | 7 |
| medical aid | 7 |
| car insurance | 7 |
| today trending | 6 |
| trending topics | 6 |
| closemeganavnavigationcontainer navigationcontainerinner | 5 |
| nbsp get | 4 |
| no document | 4 |
| id return | 4 |
| quote why | 4 |
| discovery health | 4 |
| your family | 4 |
| frequently asked | 4 |
| password log | 4 |
| friday 0700 | 4 |
| home insurance | 4 |
| insurance quote | 4 |
| asked questions | 4 |
| usernamefield usernamefieldfocus | 3 |
| documentgetelementbyidusername if | 3 |
| var usernamefield | 3 |
| questions discovery | 3 |
| usernamefield documentgetelementbyidusername | 3 |
| if usernamefield | 3 |
| public holidays | 3 |
| 99 88 | 3 |
| gap cover | 3 |
| 0860 99 | 3 |
| js-login-btn var | 3 |
| if typeof | 3 |
| documentgetelementbyidmainsearchquery if | 3 |
| targetid js-search-trigger | 3 |
| 88 77 | 3 |
| js-search-trigger var | 3 |
| usernamefieldfocus if | 3 |
| get up | 3 |
| account register | 3 |
| online account | 3 |
| healthcare professionals | 3 |
| manage your | 3 |
| quote get | 3 |
| trouble logging | 3 |
| password trouble | 3 |
| return false | 3 |
| reward partners | 3 |
| username password | 3 |
| forgot username | 3 |
| insurance life | 3 |
| your life | 3 |
| function e | 3 |
| true if | 3 |
| targetid js-mobile-nav-trigger | 3 |
| ifhasclassmobilenavtrigger is-active | 3 |
| medical scheme | 3 |
| health medical | 3 |
| life plan | 3 |
| 2017 special | 3 |
| special general | 3 |
| general meeting | 3 |
| targetid js-login-btn | 3 |
| if | 28 |
| discovery | 27 |
| insurance | 23 |
| your | 22 |
| get | 19 |
| var | 18 |
| nbsp | 17 |
| life | 15 |
| function | 13 |
| log | 12 |
| targetid | 12 |
| store | 11 |
| you | 11 |
| vitality | 11 |
| medical | 11 |
| return | 10 |
| credit | 9 |
| rewards | 9 |
| join | 9 |
| today | 9 |
| selectedmeganavid | 9 |
| car | 9 |
| call | 9 |
| quote | 9 |
| monday | 9 |
| 0860 | 9 |
| card | 8 |
| 0800 | 8 |
| us | 7 |
| register | 7 |
| new | 7 |
| aid | 7 |
| else | 7 |
| password | 7 |
| 0700 | 6 |
| cover | 6 |
| plan | 6 |
| trending | 6 |
| navigationcontainerinner | 6 |
| meganavid | 6 |
| id | 6 |
| topics | 6 |
| usernamefield | 6 |
| health | 6 |
| username | 6 |
| home | 6 |
| true | 5 |
| need | 5 |
| js-mobile-nav-trigger | 5 |
| view | 5 |
| friday | 5 |
| investments | 5 |
| closemeganavnavigationcontainer | 5 |
| false | 5 |
| site | 5 |
| undefined | 5 |
| typeof | 5 |
| benefits | 5 |
| js-search-trigger | 4 |
| no | 4 |
| document | 4 |
| up | 4 |
| forgot | 4 |
| mainsearchqueryfield | 4 |
| elementid | 4 |
| js-login-btn | 4 |
| 0 | 4 |
| questions | 4 |
| asked | 4 |
| 1 | 4 |
| frequently | 4 |
| our | 4 |
| account | 4 |
| why | 4 |
| family | 4 |
| gap | 3 |
| session | 3 |
| query | 3 |
| iframe | 3 |
| close | 3 |
| browser | 3 |
| products | 3 |
| null | 3 |
| 2 | 3 |
| 3 | 3 |
| element | 3 |
| 4 | 3 |
| sundays | 3 |
| exdays | 3 |
| contact | 3 |
| e | 3 |
| public | 3 |
| holidays | 3 |
| ifhasclassmobilenavtrigger | 3 |
| special | 3 |
| fees | 3 |
| general | 3 |
| meeting | 3 |
| scheme | 3 |
| back | 3 |
| conditions | 3 |
| terms | 3 |
| business | 3 |
| professionals | 3 |
| healthcare | 3 |
| financial | 3 |
| offers | 3 |
| can | 3 |
| details | 3 |
| online | 3 |
| is-active | 3 |
| manage | 3 |
| mobilenavtriggerclasslistremoveis-active | 3 |
| navigationcontainerinnerinnerhtml | 3 |
| usernamefieldfocus | 3 |
| documentgetelementbyidusername | 3 |
| el | 3 |
| reward | 3 |
| 5 | 3 |
| logging | 3 |
| now | 3 |
| trouble | 3 |
| partners | 3 |
| documentgetelementbyidmainsearchquery | 3 |
What are the nameservers for discovery.co.za?
Discovery.co.za Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns1.discovery.co.za |  | 84.45.8.226 |  United Kingdom |
| ns2.discovery.co.za | | 107.6.4.90 |  Canada |
| ns3.discovery.co.za | | 5.152.177.58 | United Kingdom |
