Discovery.co.za Website Analysis Summary

Discovery.co.za  |  Discovery offers a range of products including medical aid, life insurance, credit cards and investments, underpinned with Vitality rewards.
Low trust score  | 
Medical Aid, Bank, Insurance, Invest & Vitality - Discovery


Rank
13,146
Rating
F
Trust Score
Low Trust Score
Estimated worth
$1,157,040
Estimated daily income
$1,607
Estimated monthly income
$48,880
Backlinks
0

Discovery.co.za has a Low Trust Score, and a Statvoo Rank of F.

Discovery.co.za is hosted by DHN-BGP-AS2002 in Gauteng, Sandton, South Africa, 2191.
Discovery.co.za has an IP Address of 196.6.184.100 and a hostname of 196.6.184.100.

The domain discovery.co.za was registered 201 decades 9 years 4 months ago by UniForum Association, it was last modified 201 decades 9 years 4 months ago and currently is set to expire 201 decades 9 years 4 months ago.

It is the world's 13,146 most popular site among over 300 million websites.

Discovery.co.za has a total of 0 backlinks.

Discovery.co.za gets approximately 133,881 unique visitors a day and 803,286 pageviews per day.

Discovery.co.za has an estimated worth of $1,157,040.
An average daily income of approximately $1,607, which is wroughly $48,880 per month.

Whois information for discovery.co.za

Full Whois Lookup for Discovery.co.za Whois Lookup

simple CO.ZA whois server
The CO.ZA simple whois server
Copyright ZACR 1995-2017
Use of this facility subject to theterms of site usage
Your query has generated the following reply:-

Search on discovery (.co.za)
Match: One

Domain: discovery.co.za

Accounting info....
Date |Type| Cost |Invoices are E-Mail to....|Paid Date |ICnt| TrkNo |Billing Info

Flashing RED indicates that payment has not been received - please
confirm with the ZACR accounting department, Login to show email
should this
not be according to your records. You have been sent 0 invoices/statements.

0a. lastupdate :
0b. emailsource :
0c. emailposted :
0d. emailsubject :
0g. historycount :
0h. invoiceno :
0i. contracttype :
0j. rcsversion :
1a. domain : discovery.co.za
1b. action :
1c. Registrar : MarkMonitor
2a. registrant : Discovery Limited
2b. registrantpostaladdress: 155 West Street, Sandton, , Johannesburg, Gauteng, 2146, ZA
2c. registrantstreetaddress:
2d. amount :
2e. paymenttype :
2f. billingaccount :
2g. billingemail :
2i. invoiceaddress :
2j. registrantphone : +27.115294357
2k. registrantfax : +27.115294357
2l. registrantemail : Login to show email
vat :
3b. cname :
3c. cnamesub1 :
3d. cnamesub2 :
3e. creationdate : 1996/08/20 00:00:00
4a. admin :
4b. admintitle :
4c. admincompany :
4d. adminpostaladdr :
4e. adminphone :
4f. adminfax :
4g. adminemail :
4h. adminnic :
5a. tec :
5b. tectitle :
5c. teccompany :
5d. tecpostaladdr :
5e. tecphone :
5f. tecfax :
5g. tecemail :
5h. tecnic :
6a. primnsfqdn : ns1.discovery.co.za
6b. primnsip : 185.114.38.188
6c. primnsipv6 :
6e. secns1fqdn : ns2.discovery.co.za
6f. secns1ip : 107.6.4.90
6g. secns1ipv6 :
6i. secns2fqdn : ns3.discovery.co.za
6j. secns2ip : 5.152.177.58
6k. secns2ipv6 :
6m. secns3fqdn :
6n. secns3ip :
6o. secns3ipv6 :
6q. secns4fqdn :
6r. secns4ip :
6s. secns4ipv6 :
8a. netblock1start :
8b. netblock1end :
8c. netblock2start :
8d. netblock2end :
8e. netblock3start :
8f. netblock3end :
9a. description1 :
9b. description2 :
9c. description3 :
9d. description4 :
9e. description5 :
9f. description6 :

Next Query - Domain name
.co.za
Please refer to the CO.ZA contact details should you have any problems

Who hosts Discovery.co.za?

Discovery.co.za Web Server Information

Hosted IP Address:196.6.184.100
Hosted Hostname:196.6.184.100
Service Provider:DHN-BGP-AS2002
Hosted Country:South AfricaZA
Location Latitude:-26.0545
Location Longitude:28.0589
Webserver Software:Not Applicable

HTTP Header Analysis for Discovery.co.za

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 12 Jun 2015 09:05:49 GMT
Server: Apache/2.2.3 (Red Hat)
Content-Language: en-ZA
X-Powered-By: Servlet/3.0 JSP/2.2
X-Frame-Options: SAMEORIGIN
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Type: text/html; charset=ISO-8859-1
X-dynaTrace-JS-Agent: true
Transfer-Encoding: chunked

Need to find out who hosts Discovery.co.za?

Discovery.co.za Free SEO Report

Website Inpage Analysis for Discovery.co.za

H1 Headings:0
H2 Headings:0
H3 Headings:2
Your session will expire in 60 seconds.
To secure your account you have been logged out
H4 Headings:6
Earn up to 5 000 Discovery Miles with the Discovery Integrator
Get primary healthcare cover for employees in your home from R249 per month
We’ll cover their education if anything happens to you
Get up to 24 months of extra contributions allocated upfront
Make children's dreams come true with MoveToGive this festive season.
Listen to our Discover Healthier Podcast Show
H5 Headings:0
H6 Headings:4
About us
Contact us
Join Discovery
Connect with us
Total IFRAMEs:6
Total Images:8
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Discovery.co.za

password trouble logging0860 99specialfeesourbenefitsyourif usernamefieldgeneral meetingselectedmeganavidjssearchtriggerelementiddiscovery healthususernamefield usernamefieldfocus ifdocumentgetelementbyidmainsearchquery ifidinsurance life insuranceonline accounttopicsquote getexdaysspecial general meetinglife planmanagesitejsloginbtn varyouquerysundays3meetingif targetid jssearchtriggerforgot usernametruetrendingif typeoffamilyif targetid jsloginbtnonlinefriday 0700your familyusernamefield documentgetelementbyidusername iffrequently asked questionspassword troublemeganavid2017 specialyou and yourno documentsessionasked questionsloggingfunctionnavigationcontainerinnerinnerhtmlvitalityaskedforgotcontactcall 0860insurance lifepublic holidaystypeofdocumentgetelementbyidusername if usernamefield2017 special generalcanmanage yourjoininvestmentsplanonline account registerjsmobilenavtriggere5noif0860 99 88username password logdetailsstore call 0860discovery store calltargetid jssearchtrigger varlogging in needtargetid jsmobilenavtriggerdiscoverytrouble loggingusernamefieldfocus ifneedelserewardif targetidtargetid jsloginbtnviewclosemeganavnavigationcontainerholidaysoffersregisterschemejssearchtrigger varif usernamefield usernamefieldfocususernamefieldfunction enullcallifhasclassmobilenavtriggeraidsundays and publiclog in forgothome insuranceusernamefieldfocus if targetidnbsp nbsp getcarelementlog in usernamedocumentgetelementbyidmainsearchquerytargetidcar insurancegap coverfalsecovercredit cardeltargetid jsloginbtn vardocumentgetelementbyidusername ifpartnersjoin todayneed an onlineprofessionalsget uptermsbrowserquestionsclose0800today trending topicsrewardsfridayfrequently askedpublicfinancialgapcall 0860 99backjoin today trendingusernamefieldfocusmonday to fridaytrue ifbusinessusername password0nowusernamefield documentgetelementbyidusernameinsurance quoteyour lifemainsearchqueryfield99 88 772nbsp getreturnmobilenavtriggerclasslistremoveisactivehealthnewinsurance4storelognbsp nbsphealthcare professionalsjsloginbtn var usernamefieldmedicalreturn falselife insurancenavigationcontainerinnernbsp99 88mondayquestions discoverydiscovery health medicaljsloginbtnpasswordhomenbsp nbsp nbspvar usernamefield88 77documentundefinedvarmedical schemegetifhasclassmobilenavtrigger isactiveupusername and password0860generalusernamefield usernamefieldfocusasked questions discoveryreward partnershealth medicalaccount registerquotediscovery storelifeproductsisactiveyour life planmedical aidaccountusernametargetid jssearchtriggercardstore callquote why1closemeganavnavigationcontainer navigationcontainerinnervar usernamefield documentgetelementbyidusernamespecial generaltodaydocumentgetelementbyidusernamequestions discovery storecredittoday trendingwhytrending topicsconditionsiframe0700health medical schemepassword logid returnhealthcarefrequentlytrouble

Longtail Keyword Density for Discovery.co.za

KeywordsOccurences
store call 08607
discovery store call7
join today trending6
today trending topics6
nbsp nbsp nbsp6
monday to friday5
nbsp nbsp get4
you and your4
frequently asked questions4
log in forgot4
if usernamefield usernamefieldfocus3
usernamefield usernamefieldfocus if3
targetid js-search-trigger var3
if targetid js-search-trigger3
usernamefieldfocus if targetid3
99 88 773
asked questions discovery3
questions discovery store3
sundays and public3
documentgetelementbyidusername if usernamefield3
0860 99 883
call 0860 993
js-login-btn var usernamefield3
need an online3
online account register3
insurance life insurance3
logging in need3
password trouble logging3
username password log3
username and password3
your life plan3
2017 special general3
targetid js-login-btn var3
log in username3
var usernamefield documentgetelementbyidusername3
if targetid js-login-btn3
health medical scheme3
special general meeting3
discovery health medical3
usernamefield documentgetelementbyidusername if3
life insurance12
nbsp nbsp11
discovery store10
call 08609
if targetid8
credit card8
join today7
store call7
medical aid7
car insurance7
today trending6
trending topics6
closemeganavnavigationcontainer navigationcontainerinner5
nbsp get4
no document4
id return4
quote why4
discovery health4
your family4
frequently asked4
password log4
friday 07004
home insurance4
insurance quote4
asked questions4
usernamefield usernamefieldfocus3
documentgetelementbyidusername if3
var usernamefield3
questions discovery3
usernamefield documentgetelementbyidusername3
if usernamefield3
public holidays3
99 883
gap cover3
0860 993
js-login-btn var3
if typeof3
documentgetelementbyidmainsearchquery if3
targetid js-search-trigger3
88 773
js-search-trigger var3
usernamefieldfocus if3
get up3
account register3
online account3
healthcare professionals3
manage your3
quote get3
trouble logging3
password trouble3
return false3
reward partners3
username password3
forgot username3
insurance life3
your life3
function e3
true if3
targetid js-mobile-nav-trigger3
ifhasclassmobilenavtrigger is-active3
medical scheme3
health medical3
life plan3
2017 special3
special general3
general meeting3
targetid js-login-btn3
if28
discovery27
insurance23
your22
get19
var18
nbsp17
life15
function13
log12
targetid12
store11
you11
vitality11
medical11
return10
credit9
rewards9
join9
today9
selectedmeganavid9
car9
call9
quote9
monday9
08609
card8
08008
us7
register7
new7
aid7
else7
password7
07006
cover6
plan6
trending6
navigationcontainerinner6
meganavid6
id6
topics6
usernamefield6
health6
username6
home6
true5
need5
js-mobile-nav-trigger5
view5
friday5
investments5
closemeganavnavigationcontainer5
false5
site5
undefined5
typeof5
benefits5
js-search-trigger4
no4
document4
up4
forgot4
mainsearchqueryfield4
elementid4
js-login-btn4
04
questions4
asked4
14
frequently4
our4
account4
why4
family4
gap3
session3
query3
iframe3
close3
browser3
products3
null3
23
33
element3
43
sundays3
exdays3
contact3
e3
public3
holidays3
ifhasclassmobilenavtrigger3
special3
fees3
general3
meeting3
scheme3
back3
conditions3
terms3
business3
professionals3
healthcare3
financial3
offers3
can3
details3
online3
is-active3
manage3
mobilenavtriggerclasslistremoveis-active3
navigationcontainerinnerinnerhtml3
usernamefieldfocus3
documentgetelementbyidusername3
el3
reward3
53
logging3
now3
trouble3
partners3
documentgetelementbyidmainsearchquery3

What are the nameservers for discovery.co.za?

Discovery.co.za Domain Nameserver Information

HostIP AddressCountry
ns1.discovery.co.za 84.45.8.226United Kingdom United Kingdom
ns2.discovery.co.za 107.6.4.90Canada Canada
ns3.discovery.co.za 5.152.177.58United Kingdom United Kingdom