Disneylandparis.de Favicon Disneylandparis.de

Disneylandparis.de Website Thumbnail
Checking...
Disneyland Paris - Tickets, Shows, Hotels | Disneyland Paris
Low trust score
 | 
Add a review Change category Claim this site
Willkommen auf der offiziellen Website von Disneyland Paris. Entdecken Sie 2 Disney Parks, 7 Disney Hotels, einen Golfplatz und Disney Village - für noch mehr Zauber und Spaß.


Domain summary

Domain label
disneylandparis
Domain extension
de
Global Traffic Rank
0
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is disneylandparis.de ranked relative to other sites:

Percentage of visits to disneylandparis.de from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Disneylandparis.de registered?
A: Disneylandparis.de was registered 2 weeks, 5 days, 22 hours, 33 minutes, 32 seconds ago on Friday, September 11, 2020.
Q: When was the WHOIS for Disneylandparis.de last updated?
A: The WHOIS entry was last updated 4 months, 1 week, 1 day, 22 hours, 33 minutes, 32 seconds ago on Friday, May 22, 2020.
Q: What are Disneylandparis.de's nameservers?
A: DNS for Disneylandparis.de is provided by the following nameservers:
  • ns1.disneylandparis.com
  • ns2.disneylandparis.com
  • ns3.disneylandparis.com
  • ns4.disneylandparis.com
Q: Who is the registrar for the Disneylandparis.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Disneylandparis.de?
A: Disneylandparis.de has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Disneylandparis.de each day?
A: Disneylandparis.de receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Disneylandparis.de resolve to?
A: Disneylandparis.de resolves to the IPv4 address 139.104.191.6.
Q: In what country are Disneylandparis.de servers located in?
A: Disneylandparis.de has servers located in the United States.
Q: What webserver software does Disneylandparis.de use?
A: Disneylandparis.de is powered by Apache/2.4.6 (Red Hat Enterprise Linux) webserver.
Q: Who hosts Disneylandparis.de?
A: Disneylandparis.de is hosted by Disney Online in United States.
Q: How much is Disneylandparis.de worth?
A: Disneylandparis.de has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Disneylandparis.de?

Disneylandparis.de Hosting Provider Information

Hosted IP Address:139.104.191.6
Hosted Hostname:139.104.191.6
Service Provider:Disney Online
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Apache/2.4.6 (Red Hat Enterprise Linux)

Is "Disney Online" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Disneylandparis.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Apache/2.4.6 (Red Hat Enterprise Linux)
XServer: K2 (prod8-prod76-76)
Vary: Accept-Encoding
Referrer-Policy: origin-when-cross-origin, strict-origin-when-cross-origin
X-Frame-Options: DENY
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
X-Permitted-Cross-Domain-Policies: master-only
Content-Type: text/html; charset=UTF-8
Content-Encoding: gzip
Expires: Fri, 11 Sep 2020 01:19:14 GMT
Cache-Control: max-age=0, no-cache, no-store
Pragma: no-cache
Date: Fri, 11 Sep 2020 01:19:14 GMT
Content-Length: 28915
Connection: keep-alive

Disneylandparis.de Domain Nameserver Information

HostIP AddressCountry
ns1.disneylandparis.com 205.251.192.108
ns2.disneylandparis.com 205.251.194.115
ns3.disneylandparis.com 205.251.198.166
ns4.disneylandparis.com 205.251.197.242


Need to find out who hosts Disneylandparis.de?


WhoIs information for Disneylandparis.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: disneylandparis.de
Nserver: ns1.disneylandparis.com
Nserver: ns2.disneylandparis.com
Nserver: ns3.disneylandparis.com
Nserver: ns4.disneylandparis.com
Status: connect
Changed: 2020-05-22T22:10:23+02:00

Disneylandparis.de Free SEO Report

Website Inpage Analysis for Disneylandparis.de

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

7 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

13:
  1. No text
    https://www.disneylandparis.com/de-de
  2. Öffnungszeiten der Parks
    https://www.disneylandparis.com/de-de/kalender/oeffnungszeiten/
  3. No text
    https://www.disneylandparis.com/language-selection/
  4. UNSERE PARKS
    https://www.disneylandparis.com/de-de/ueberblick/
  5. HOTELS & RESORTS
    https://www.disneylandparis.com/de-de/hotels/
  6. RESTAURANTS
    https://www.disneylandparis.com/de-de/restaurants/
  7. TICKETS UND PAUSCHALEN
    https://www.disneylandparis.com/de-de/angebote/
  8. VOR IHRER ANKUNFT
    https://www.disneylandparis.com/de-de/hilfe/
  9. No text
    https://www.facebook.com/DisneylandParisde/
  10. No text
    https://www.youtube.com/user/disneylandparis
  11. No text
    https://instagram.com/disneylandparis/
  12. No text
    http://www.twitter.com/disneyparis_en
  13. www.disneylandparis.com/de-de/sicherheit-und-hygiene/
    https://www.disneylandparis.com/de-de/sicherheit-und-hygiene/

Links - Outbound (nofollow)

0:

Keyword Cloud for Disneylandparis.de

sie sichjeden tagumgebungeinesminuten zugelten diedisneydenaufgenieennachbedingungensie diedisneypark unterschiedlichendem deutschenzum zeitpunktdisney parks erreichenbieteninmittenfinden sierechtedisney parks jedenwiedererffnung von disneylandimextradienstleistungennichtnuratmosphrefuwiehatparks erreichen siehotel santadasskann jeperihre persnlichen informationenminuten mit demminutenpersnlichen informationenkann je nachzauberhafteeinen oderverfgbarkeit angebotenentdecken siekostenlosen shuttlebuswerden sieextra zeit wirdverffentlichung zauberhaftetag frheresderdie disneyfr ihrensie unsverffentlichung zauberhafte extraje nach verfgbarkeitangeboten und kanngeltendisneyland pariswenigen minuteneine13 80 41aus demder disney parkscentersie unsereauf derzum zeitpunkt dermehrerewird jeentdeckenextra zeitnormaltarifaushotelsknnenihrbittewenigen minuten mitihrensantader verffentlichung zauberhaftemarvelunterschiedlichenparksesnur wenige minutenparks jeden tageinerdurchfu odergelten die bedingungennach verfgbarkeit angebotensie den zauberdiesesnormaltarif ausfrheres geltendemzeitpunktihrenur wenigenshowserreichensindeinemvillagedisneyparkdem kostenlosen shuttlebusdie bedingungen zumjeden1informationenzauber der disneymit demoderden zauber dermit dem kostenlosenstilgenieen sie denunsdisneylandunterschiedlichen bedingungenaufenthalt4frheres3mehrsichden disneyzauberzeitpunkt dertag frheres geltenzeitvon denshuttlebus von densie eindaswerdentagzauberhafte extrajeden tag frherespaarhierwebsitesie eineparkgesundheitseinparks jeden13 80aus dem deutschenbernach verfgbarkeitticketsgenieen sie2wenige minutendesje nach disneyparkjeumfr dieverwendennur wenigen minutenhotelein paarmitnaturevon disneyland pariswenigekostenlosenticketverffentlichungsie in nurnur wenigezauberhafte extra zeitalssie ihrenach disneyparkfrwildenje nacherhaltenerwartetder verffentlichungentfernt und genieendie bedingungenbedingungen zum zeitpunktshuttlebus vonden disney parksdisney studiosvalstudiosnach disneypark unterschiedlichen0minuten zu fudieihrerentferntistzudisney villagewiedererffnung vondisneypark unterschiedlichen bedingungensind nichtwirdvonsie denwalt disneyallzeit wird jeparks entferntzimmerminuten miterwartet sieangebotenparks erreichenden zauberbedingungen zumvon den disneydisney parkserreichen sieunserenihnenbucheneinenzu fu oderwaltder disneywiedererffnungunserezumzeit wirdzauber derdem kostenlosenvon disneylandwirverfgbarkeitkannmit dendie disney parksdieserparispersnlichendisneyswird je nachamwenigen80 41normaltarif aus demzu fufindendiesemzeitpunkt der verffentlichungihre persnlichensiemit einemshuttlebushabendeutschennew

Longtail Keyword Density for Disneylandparis.de

KeywordsOccurences
mit dem kostenlosen9
von disneyland paris7
minuten mit dem7
13 80 416
aus dem deutschen6
normaltarif aus dem6
der verffentlichung zauberhafte5
kann je nach5
nach verfgbarkeit angeboten5
je nach verfgbarkeit5
wird je nach5
zeit wird je5
extra zeit wird5
zauberhafte extra zeit5
verffentlichung zauberhafte extra5
angeboten und kann5
zeitpunkt der verffentlichung5
bedingungen zum zeitpunkt5
zum zeitpunkt der5
sie den zauber4
den disney parks4
die disney parks4
nur wenigen minuten4
wenigen minuten mit4
den zauber der4
zauber der disney4
der disney parks4
disney parks jeden4
parks jeden tag4
gelten die bedingungen4
die bedingungen zum4
parks erreichen sie3
von den disney3
nur wenige minuten3
tag frheres gelten3
jeden tag frheres3
disney parks erreichen3
wiedererffnung von disneyland3
genieen sie den3
entfernt und genieen3
shuttle-bus von den3
dem kostenlosen shuttle-bus3
zu fu oder3
minuten zu fu3
disneypark unterschiedlichen bedingungen3
nach disneypark unterschiedlichen3
je nach disneypark3
ihre persnlichen informationen3
sie in nur3
disney parks16
von disneyland14
disneyland paris12
mit dem12
sie sich12
je nach11
dem kostenlosen9
minuten mit8
sie die8
sie den8
den disney8
dem deutschen6
sie ein6
13 806
zauberhafte extra6
aus dem6
normaltarif aus6
80 416
der disney6
wird je5
zauber der5
zeit wird5
extra zeit5
verffentlichung zauberhafte5
der verffentlichung5
verfgbarkeit angeboten5
zeitpunkt der5
jeden tag5
nach verfgbarkeit5
zum zeitpunkt5
kann je5
entdecken sie5
unterschiedlichen bedingungen5
bedingungen zum5
sie ihre5
von den5
sie eine5
wenigen minuten5
genieen sie4
den zauber4
die disney4
nur wenigen4
kostenlosen shuttle-bus4
sie unsere4
die bedingungen4
gelten die4
finden sie4
disney studios4
werden sie4
sind nicht4
erwartet sie4
parks jeden4
einen oder3
shuttle-bus von3
parks erreichen3
wiedererffnung von3
mit den3
wenige minuten3
nur wenige3
frheres gelten3
tag frheres3
mit einem3
parks entfernt3
disney village3
fr die3
hotel santa3
ein paar3
auf der3
sie uns3
fu oder3
zu fu3
minuten zu3
fr ihren3
disneypark unterschiedlichen3
nach disneypark3
walt disney3
ihre persnlichen3
persnlichen informationen3
erreichen sie3
sie103
disney50
die44
der40
von33
zu32
den32
disneyland31
mit29
parks23
dem22
fr21
hotel21
ein20
paris20
sich18
oder18
das16
eine16
ihre16
des14
nach14
minuten14
zauber12
nur12
einen11
im11
je11
nicht11
bedingungen10
zum10
kostenlosen10
aus10
informationen9
sind9
hotels9
um9
tag8
uns8
ihrer8
knnen8
werden8
unsere8
ist8
einem8
es7
zauberhafte7
haben7
diesem7
unseren7
wird7
zeit7
06
mehr6
16
zeitpunkt6
bitte6
kann6
26
normaltarif6
aufenthalt6
extra6
auf6
deutschen6
verfgbarkeit6
als6
gelten6
stil5
buchen5
entdecken5
ihren5
unterschiedlichen5
angeboten5
new5
wir5
dieses5
ihnen5
ihr5
ber5
village5
shuttle-bus5
wenigen5
verffentlichung5
entfernt5
hier5
jeden5
dieser4
genieen4
erwartet4
disneys4
walt4
nature4
dienstleistungen4
wie4
bieten4
finden4
verwenden4
studios4
shows4
marvel4
erhalten4
santa3
dass3
33
persnlichen3
fu3
durch3
hat3
gesundheits-3
frheres3
wenige3
umgebung3
atmosphre3
wiedererffnung3
erreichen3
disneypark3
ticket3
eines3
einer3
website3
tickets3
wilden3
park3
mehrere3
zimmer3
paar3
am3
center3
inmitten3
43
all3
per3
rechte3
val3

Disneylandparis.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Disneylandparis.de is a scam?

Websites with Similar Names

Disnea.org
依頼する前に知っておきたいポイントをチェック|House cleaning
Disnefoodblog.com
disnefoodblog.com
Disneiland.com
disneiland.com
Disneilend.com
edf一定发-一定发官方网站-一定发娱乐
Disnemovies.com
Watch Movies and TV Series Stream Online
Disneology.com
Just a moment...

Recently Updated Websites

Lespetitesbavouilles.com 2 seconds ago.Soitin-huttunen.com 2 seconds ago.Mhecriticalreadingprogram.com 3 seconds ago.Lesmimipinson.com 4 seconds ago.Bjwny.com 4 seconds ago.Cmgroupcompany.com 5 seconds ago.Mainstreetsoul.com 5 seconds ago.Pinjamkoperasi.com 6 seconds ago.Engelsjewelry.com 6 seconds ago.A1homes.co.nz 7 seconds ago.Firehousecafe.com 7 seconds ago.Bestcareermatch.com 7 seconds ago.Whfishinggear.cn 7 seconds ago.Isqed.com 8 seconds ago.Cotet.net 10 seconds ago.Actgrassroots.info 10 seconds ago.Brentwoodpta.com 10 seconds ago.Marketingnews.ru 10 seconds ago.Vishalon.net 10 seconds ago.Sprintfacilitator.com 11 seconds ago.Manta-ray-valves.com 11 seconds ago.Marketingxpress.de 11 seconds ago.Vanitiz.com 12 seconds ago.Menshanger.com 12 seconds ago.Sweetpornlinks.com 12 seconds ago.Sharefreak.com 12 seconds ago.Fourthfruit.com 13 seconds ago.Grimaldicommercialrealty.com 13 seconds ago.Asianleadershipawards.com 13 seconds ago.Bingonoveltyworld.com 13 seconds ago.