Dnes.bg

Website Thumbnail
Checking...
Последни Новини от DNES.BG

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 71,347
Estimated Worth: $213,120
Last updated:2020-10-25
Category: News and Media

Новинарски сайт за новини от България и света на теми - спорт, технологии, социално-културни, здраве, криминалистика, автомобили, политика.


Domain summary

Domain label
dnes
Domain extension
bg
Global Traffic Rank
71,347
Statvoo Rating
E
Trust Score
Low Trust Score
Estimated worth
$213,120
Estimated daily income
$296
Estimated monthly income
$9,003

Rank summary

How is dnes.bg ranked relative to other sites:

Percentage of visits to dnes.bg from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Dnes.bg registered?
A: Dnes.bg was registered 1 month, 1 week, 15 hours, 37 minutes, 7 seconds ago on Sunday, October 25, 2020.
Q: When was the WHOIS for Dnes.bg last updated?
A: The WHOIS entry was last updated 1 month, 1 week, 15 hours, 37 minutes, 7 seconds ago on Sunday, October 25, 2020.
Q: What are Dnes.bg's nameservers?
A: DNS for Dnes.bg is provided by the following nameservers:
  • ns6.gotobg.net
  • ns5.gotobg.net
Q: Who is the registrar for the Dnes.bg domain?
A: The domain has been registered at .
Q: What is the traffic rank for Dnes.bg?
A: Dnes.bg ranks 71,347 globally on Alexa. Dnes.bg has a Low Trust Score, and a Statvoo Rank of E.
Q: How many people visit Dnes.bg each day?
A: Dnes.bg receives approximately 24,668 visitors and 148,008 page impressions per day.
Q: What IP address does Dnes.bg resolve to?
A: Dnes.bg resolves to the IPv4 address 194.12.229.102.
Q: In what country are Dnes.bg servers located in?
A: Dnes.bg has servers located in the Bulgaria.
Q: What webserver software does Dnes.bg use?
A: Dnes.bg is powered by Apache/2.2.3 (CentOS) webserver.
Q: Who hosts Dnes.bg?
A: Dnes.bg is hosted by Lirex net EOOD in Bulgaria.
Q: How much is Dnes.bg worth?
A: Dnes.bg has an estimated worth of $213,120. An average daily income of approximately $296, which is roughly $9,003 per month.

Dnes.bg Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Dnes.bg Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Dnes.bg

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-367826-5

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Dnes.bg

childheightslide1113flexprevon click functioneslides liwidth caritemoffset20032014slides lilength carwidthtopnews topnewsslidercsswidthleadingright slidesanimate leftcaritemwidth caritemsnum 8mymaster pvmgu0snf99ww3opzdxkzz7qaxi8srtukttgsuvpo78functione epreventdefault if8 setting carousellilength carwidth caritemsnumcarwidth caritemsnumcarouselfunctionedivgolslow2viasat3asidenews6sports0pxcaritemoffsetcaritemwidthleft 0px slowcadocean 20032014l920032012caritemoffsetpx slownational geographicblockmtvsetting carouselfinvestigationcovid19geographicleadingleft slidesanimateslides lilengthcaritemsnum 8document1investorbgdnesbgdneselsehbopreviousnextleadingright slidesanimatemaxheightcaritemwidth caritemsnumflexprevon1418caritemoffsetpxdivgol slidesanimate leftleft 0px100px slowslidesanimate leftwidthlilengthcarwidthcadocean 20032012flexnexton clicktravelepreventdefault var caritemwidthcarwidth if7seltabtopnewsslidercsswidth carwidthclick functioneslidescssleft 0pxpvmgu0snf99ww3opzdxkzz7qaxi8srtukttgsuvpo7flexprevon clickanimationcaritemwidth28 caritemsnumvarslidesanimate left caritemoffsetpxleadingrighttrueslidesleadingleftslidesanimatecadoceandocument readyfunctionepreventdefaultleft caritemoffsetpxmax12asidetabswrap8 settingflexnexton click functionecaritemsnum 8 settingfalsevar caritemwidthpreviousnext documentmymaster pvmgu0snf99ww3opzdxkzz7qaxi8srtukttgsuvpo7 googletagcmdpushfunction4aircarousel widthfilmboxbloomberg tvpcrtopnews topnewsslidercsswidth carwidthepreventdefault varsettingfunctione epreventdefaultnoneclickcovid 37liwidth caritemoffset caritemwidth28functiondiscoveryquotchannelfoxslidesanimate left 0pxgoogletagcmdpushfunctionslides liwidthsportdivgol slidesanimateleftcaritemsnum19bloombergtopnewsslidercsswidth carwidth ifbulgariatvbulgaria on airaxnreadyfunctioncarwidth caritemsnum caritemwidthcaritemwidth28leadingleft slidesanimate left1516divtialoto slidesanimate leftmax sportleft caritemoffsetpx slowclick functione epreventdefaultcaritemoffset caritemwidth28jqueryifnetworkpvmgu0snf99ww3opzdxkzz7qaxi8srtukttgsuvpo7 googletagcmdpushfunctionliwidth caritemoffsethdbtv5mymasterlilength carwidthplanetaepreventdefault ifeurosportfunctione epreventdefault varhistoryserver investorbgadoceanplcovid0caritemoffset caritemwidth28 caritemsnumboxtvinvestorbgadoceanplnovanationalbloomberg tv bulgariaadoplacementidheadersearchasidetabsnavdivtialoto slidesanimatetopnewsslidescssleftservercaritemsnum caritemwidthcaritemoffsetpx slow elsetv bulgaria17liwidthsetting carousel widthdnescartabidflexnextoncaritemsnum caritemwidth caritemsnumslow elseboxtv asidetabswraptopnewsslidercsswidthdivtialotopreviousnext document readyfunction

Longtail Keyword Density for Dnes.bg

KeywordsOccurences
slidesanimate left 0px8
click functione epreventdefault8
left 0px slow8
mymaster pvmgu0snf99ww3opzdxkzz7qaxi8srtukttgsuvpo7 googletagcmdpushfunction6
setting carousel width4
top-news-slidercsswidth carwidth if4
leading-left slidesanimate left4
slidesanimate left -caritemoffsetpx4
left -caritemoffsetpx slow4
-caritemoffsetpx slow else4
flex-prevon click functione4
functione epreventdefault if4
slidesanimate left caritemoffsetpx4
left caritemoffsetpx slow4
caritemoffsetpx slow else4
leading-right slidesanimate left4
top-news top-news-slidercsswidth carwidth4
8 setting carousel4
divgol slidesanimate left4
caritemsnum 8 setting4
caritemwidth caritemsnum 84
caritemsnum caritemwidth caritemsnum4
carwidth caritemsnum caritemwidth4
lilength carwidth caritemsnum4
slides lilength carwidth4
caritemoffset caritemwidth28 caritemsnum4
liwidth caritemoffset caritemwidth284
slides liwidth caritemoffset4
epreventdefault var caritemwidth4
functione epreventdefault var4
flex-nexton click functione4
previousnext document readyfunction4
divtialoto slidesanimate left4
bulgaria on air3
bloomberg tv bulgaria3
slidesanimate left16
mymaster pvmgu0snf99ww3opzdxkzz7qaxi8srtukttgsuvpo715
left 0px8
slidescssleft 0px8
click functione8
functione epreventdefault8
slow else8
0px slow8
pvmgu0snf99ww3opzdxkzz7qaxi8srtukttgsuvpo7 googletagcmdpushfunction6
carwidth if4
leading-left slidesanimate4
left -caritemoffsetpx4
-caritemoffsetpx slow4
flex-prevon click4
top-news top-news-slidercsswidth4
epreventdefault if4
left caritemoffsetpx4
caritemoffsetpx slow4
leading-right slidesanimate4
divtialoto slidesanimate4
divgol slidesanimate4
top-news-slidercsswidth carwidth4
carousel width4
setting carousel4
caritemoffset caritemwidth284
previousnext document4
document readyfunction4
flex-nexton click4
epreventdefault var4
slides liwidth4
liwidth caritemoffset4
var caritemwidth4
caritemwidth28 caritemsnum4
caritemwidth caritemsnum4
slides lilength4
caritemsnum 84
8 setting4
caritemsnum caritemwidth4
carwidth caritemsnum4
lilength carwidth4
max sport4
cadocean 2003-20123
covid 373
server investorbgadoceanpl3
cadocean 2003-20143
boxtv aside-tabs-wrap3
bloomberg tv3
tv bulgaria3
national geographic3
mymaster17
0px16
slow16
left16
slidesanimate16
pvmgu0snf99ww3opzdxkzz7qaxi8srtukttgsuvpo715
014
if13
tv13
caritemsnum12
leading-right11
false11
cadocean11
divtialoto11
divgol11
hd11
leading-left11
true10
epreventdefault10
else10
function9
click9
19
var9
covid-198
slides8
slidescssleft8
carwidth8
channel8
sport8
functione8
caritemwidth8
27
37
googletagcmdpushfunction7
47
-6
56
document6
66
btv6
bulgaria6
investorbgdnesbgdnes6
76
85
95
header-search5
aside-news5
covid5
105
boxtv5
discovery5
none4
aside-tabs-nav4
seltab4
cartabid4
quot4
caritemoffset4
114
mtv4
viasat4
liwidth4
max4
setting4
caritemoffsetpx4
carousel4
width4
top-news4
readyfunction4
lilength4
top-news-slidercsswidth4
previousnext4
124
-caritemoffsetpx4
flex-prevon4
flex-nexton4
block4
l4
caritemwidth284
travel3
filmbox3
dnes3
axn3
history3
investigation3
f3
fox3
network3
eurosport3
sports3
geographic3
national3
planeta3
hbo3
133
2003-20143
nova3
143
153
163
investorbgadoceanpl3
animation3
slide3
server3
adoplacementid3
173
bloomberg3
2003-20123
air3
jquery3
pcr3
maxheight3
childheight3
183
aside-tabs-wrap3
193

Who hosts Dnes.bg?

Dnes.bg Hosting Provider Information

Hosted IP Address:194.12.229.102
Hosted Hostname:194.12.229.102
Service Provider:Lirex net EOOD
Hosted Country:BulgariaBG
Location Latitude:42.696
Location Longitude:23.332
Webserver Software:Apache/2.2.3 (CentOS)

Is "Lirex net EOOD" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
Lirex net EOOD
0.0009%

HTTP Header Analysis for Dnes.bg

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 25 Oct 2020 05:33:26 GMT
Server: Apache/2.2.3 (CentOS)
X-Powered-By: PHP/5.1.6
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding
Content-Encoding: gzip
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html;charset=windows-1251

Dnes.bg Domain Nameserver Information

HostIP AddressCountry
ns6.gotobg.net 173.237.189.30United States United States
ns5.gotobg.net 173.237.189.29United States United States


Need to find out who hosts Dnes.bg?


Domain Registration (WhoIs) information for Dnes.bg

Websites with Similar Names

Dnes-host.com
DNES HOSTING STORE - Co-Location, Server, Domains, Reseller Hosting, Webhosting, DNS, Domain Name Service, WebControl Panel, SSL-Zertifikate, POP3, Sub-Domains, SSH-Zugang, Linux, MySQL, Cronjobs
Dnes.bg
Последни Новини от DNES.BG
Dnes.top
Dnes.TOP - Novinky a aktuality pre každého
Dnes.tv
iDNES.tv
Dnes24.sk
Správy z regiónov, aktuality z domova a zo sveta | Dnes24.sk
Dnesbg.com
Янтра ДНЕС live | Новини от Велико Търново и региона

Recently Updated Websites

Iknowfashionshop.com (2 seconds ago.)Dcflora.com (4 seconds ago.)Kristianrichards.com (4 seconds ago.)Kinaxixi.com (6 seconds ago.)Dianshitvb.com (7 seconds ago.)Laukpedia.com (9 seconds ago.)Diariesofaselfsaboteur.com (9 seconds ago.)Iii1851.com (13 seconds ago.)Donttrustboris.com (14 seconds ago.)Dengehaberlesme.com (15 seconds ago.)Indexnonwovens-virtual.com (17 seconds ago.)Donnieamin.com (18 seconds ago.)Cubasinenglish.com (21 seconds ago.)Dehashing.com (23 seconds ago.)Lacquerandoil.com (23 seconds ago.)Icasinternationalshop.com (24 seconds ago.)Iembike.com (24 seconds ago.)Indi-o.com (25 seconds ago.)Datacoffeefilms.com (26 seconds ago.)Im233.com (29 seconds ago.)Lampswell.com (31 seconds ago.)Dapengshebbei.com (31 seconds ago.)Idiarto.com (31 seconds ago.)Ddscamellia-289.com (33 seconds ago.)Juancontrerashomes.com (41 seconds ago.)Jujiri.com (43 seconds ago.)Deanzaestate.com (44 seconds ago.)Denrizmet.com (48 seconds ago.)Defeliceautoservice.com (49 seconds ago.)Domdombet678.com (50 seconds ago.)

Recently Searched Keywords

kei san vietnam (1 second ago.)volatility stats (1 second ago.)fa fa-list-alt (1 second ago.)vonbis (1 second ago.)border-left 1px solid (2 seconds ago.)lsi (2 seconds ago.)mtjgd (2 seconds ago.)ark-header navbar-toggle margin-top (2 seconds ago.)7 prly (3 seconds ago.)line-height 1 (3 seconds ago.)entlang der lahn (3 seconds ago.)urla d opacity (3 seconds ago.)ffb-list-item-4 ffb-one-icon (4 seconds ago.)uldropdown-menu licurrent-menu-ancestoraffb-ark-sub-level-menu color937a61media (4 seconds ago.)lahn dill kanu (4 seconds ago.)radwege anzeigen (4 seconds ago.)iglomen zarobki (4 seconds ago.)padding-bottom 225px (5 seconds ago.)ffb-id-3v0t3rmvbeforeffb-id-3v0t3rmvafterffb-id-3v0t3rmvhoverffb-id-3v0t3rmvfocusffb-id-3v0t3rmv ffb-id-3v0t3rmv (5 seconds ago.)persönlich (5 seconds ago.)icon-set-lsiwidget-2 (5 seconds ago.)ママ手コキ 133 (5 seconds ago.)diedinhouse (5 seconds ago.)margin-top 325px (6 seconds ago.)thu oct 15 (6 seconds ago.)alle nieuws (6 seconds ago.)inconnexio (6 seconds ago.)8 hidden graphic tee illus (7 seconds ago.)match en cours (7 seconds ago.)nybygning (7 seconds ago.)