Doe.gov.my  |  Jabatan Alam Sekitar | Kementerian Sumber Asli & Alam Sekitar
Low trust score  | 

Doe.gov.my Website Information

Doe.gov.my has a Low Trust Score, a Statvoo Rank of G, an Alexa Rank of 238,266, a Majestic Rank of 456,371, a Domain Authority of 53% and is not listed in DMOZ.

Doe.gov.my is hosted by GITN (M) Sdn. Bhd. in Kuala Lumpur, Kuala Lumpur, Malaysia, 50480.
Doe.gov.my has an IP Address of 202.75.5.5 and a hostname of www.jas.gov.my.

The domain doe.gov.my was registered 201 decades 8 years 9 months ago by , it was last modified 201 decades 8 years 9 months ago and currently is set to expire 201 decades 8 years 9 months ago.


Who hosts Doe.gov.my?

Doe.gov.my Web Server Information

Hosted IP Address:202.75.5.5
Hosted Hostname:www.jas.gov.my
Service Provider:GITN (M) Sdn. Bhd.
Hosted Country:MalaysiaMY
Location Latitude:3.1412
Location Longitude:101.687
Webserver Software:Not Applicable

HTTP Header Analysis for Doe.gov.my

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 20 Aug 2015 20:04:23 GMT
Server: Apache/2.2.15 (CentOS)
X-Frame-Options: SAMEORIGIN
X-Powered-By: PHP/5.6.6
X-Pingback: http://www.doe.gov.my/portalv1/xmlrpc.php
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8


Need to find out who hosts Doe.gov.my?

Doe.gov.my Free SEO Report

Website Inpage Analysis for Doe.gov.my

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Doe.gov.my

laporankoleksi arkibpaparanjabatan alam sekitarsenaraiseranta awam atasmaklumatjasnbsp113kes mahkamahborder3px solidothertaliankualiti alam sekelilingkesanease opacitypetamenteriumum0industri hijau1s easeperunding eiaaudit alamketuakoleksiaplikasiatassekitar pengumumanqtranxswidget ulbersihmargin 02016 kenyataan akhbar2012 nbsp1maypengumumanaprilkursussumber asliawam atas talian038alamperolehansekitar kementerian sumberraseiaalam sekitar kementeriannbsp3pemuliharaan alamseptember 2016nbsp7september 2016 kenyataanborder3px solid rgba218218218114juru audit alamlaporan penilaianalam sekitar pengumuman1marginsolid2017 nbsp2nbsp1 octoberperinciankualitidecemberborder3pxpiagam pelangganparapenilaian kesanpaparan kes mahkamahborderradius5px incccshortcodewrapkepada alamjuru auditsistem pengurusan10danbagibuangan terjaduallaporan penilaian kesancontrol1sqtranxswidgetawam atasmarchatas talian1s ease opacitykesekitar kementerianborderradius5pxakhbarkualiti alamkerajaanrgba2182182181audit alam sekitarwphccshortcodecontent12industrirakan alam sekitarpaparan kesgaleripelanggansumberdasarnbsp13garisarkibeasepiagambuanganincccshortcodewrapsekelilingperkhidmatan atasjurupelaporanctalabelul5facebooknbsp6perolehan arkibpendaftaranaktivitijabatanudara11opacitynbsp2 october2016 kenyataanperaturanperaturanpemuliharaan2novemberpengurusanseptemberaktasectionjanuarymobilekeskepada alam sekelilingjabatan alamkepadaperundingserantapensijilankesan kepadaaduanterjadualnbsp3 novembernbsp44julyportal rasmipermohonanenvirountukairkementerian sumber aslirssarkib perincian8solid rgba2182182181perkhidmatan atas taliannbsp23kesedaranmelaluidatapemuliharaan alam sekitarlamantruergba2182182181 incccshortcodewrapaslipusatarkib perincian perolehanbersamaawamhijaumalaysiaalam sekelilingrasmidi2013 nbsp1skimsisaogospencemaran udarajunewphmodalcontentkementerian sumberkesan kepada alamalam sekitarsegmennbsp5panduaninisiatifpencemarankenyataanrakaninfoportalpemajulatihanfebruaryauditakhbar kementeriankenyataan akhbarmahkamahakhbar kementerian sumberkementerian6soalanaugustpenilaianperkhidmatannbsp1 novembermaklumat untukdalamsekitaroctoberpenilaian kesan kepadayangrakan alamnbsp89sistemhubungigaris panduansolid rgba2182182181 incccshortcodewrapkenyataan akhbar kementerianperincian perolehanseranta awamnbsp2 augustms7

Longtail Keyword Density for Doe.gov.my

KeywordsOccurences
jabatan alam sekitar13
kementerian sumber asli8
border3px solid rgba21821821816
kenyataan akhbar kementerian5
rakan alam sekitar5
akhbar kementerian sumber5
audit alam sekitar5
perkhidmatan atas talian4
2016 kenyataan akhbar4
pemuliharaan alam sekitar4
juru audit alam4
1s ease opacity4
kualiti alam sekeliling4
arkib perincian perolehan3
solid rgba2182182181 incccshortcodewrap3
september 2016 kenyataan3
alam sekitar kementerian3
sekitar kementerian sumber3
kesan kepada alam3
awam atas talian3
seranta awam atas3
alam sekitar pengumuman3
laporan penilaian kesan3
paparan kes mahkamah3
penilaian kesan kepada3
kepada alam sekeliling3
alam sekitar46
jabatan alam13
atas talian10
sumber asli9
kenyataan akhbar8
kementerian sumber8
industri hijau7
alam sekeliling7
perunding eia6
border3px solid6
solid rgba21821821816
qtranxswidget ul5
rakan alam5
2017 nbsp25
2012 nbsp15
kes mahkamah5
akhbar kementerian5
audit alam5
koleksi arkib4
kualiti alam4
perolehan arkib4
juru audit4
pemuliharaan alam4
2016 kenyataan4
perkhidmatan atas4
1s ease4
ease opacity4
september 20164
nbsp2 october3
nbsp3 november3
nbsp1 november3
2013 nbsp13
rgba2182182181 incccshortcodewrap3
border-radius5px incccshortcodewrap3
portal rasmi3
piagam pelanggan3
arkib perincian3
nbsp2 august3
nbsp1 october3
kesan kepada3
garis panduan3
pencemaran udara3
buangan terjadual3
maklumat untuk3
seranta awam3
awam atas3
margin 03
perincian perolehan3
penilaian kesan3
paparan kes3
laporan penilaian3
sistem pengurusan3
sekitar kementerian3
sekitar pengumuman3
kepada alam3
alam55
sekitar46
dan18
017
jabatan17
eia16
jas16
maklumat15
nbsp214
03814
talian14
industri13
113
213
312
arkib12
412
nbsp112
awam11
atas11
pengumuman11
perunding10
malaysia10
hijau10
akhbar10
510
kepada9
september9
di9
sumber9
asli9
kenyataan8
kualiti8
kementerian8
august8
68
udara8
facebook8
aktiviti7
perolehan7
november7
laporan7
untuk7
sekeliling7
77
pendaftaran7
opacity7
perkhidmatan7
nbsp37
july7
april6
audit6
pemaju6
march6
june6
qtranxswidget6
may6
bagi6
february6
october6
solid6
umum6
rgba21821821816
pengurusan6
border-radius5px6
incccshortcodewrap6
true6
border3px6
melalui5
data5
paparan5
january5
85
ras5
ul5
rakan5
kerajaan5
senarai5
mahkamah5
kes5
kursus5
koleksi5
ogos4
ease4
yang4
1s4
ctalabel4
para4
dalam4
wph-modal--content4
section4
nbsp64
info4
december4
nbsp134
segmen4
enviro4
nbsp54
wph-cc-shortcode--content4
galeri4
sistem4
bersih4
latihan4
pusat4
aduan4
buangan4
portal4
akta4
pemuliharaan4
inisiatif4
sisa4
juru4
panduan4
94
mobile4
103
seranta3
113
rasmi3
pensijilan3
other3
margin3
nbsp83
ms3
perincian3
menteri3
bersama3
dasar3
ketua3
penilaian3
piagam3
kesedaran3
kesan3
pelanggan3
soalan3
nbsp43
skim3
pelaporan3
permohonan3
rss3
laman3
123
peta3
133
aplikasi3
143
ke3
air3
hubungi3
terjadual3
garis3
peraturan-peraturan3
pencemaran3
control3
nbsp73

What are the nameservers for doe.gov.my?

Doe.gov.my Domain Nameserver Information

HostIP AddressCountry
dns2.gitn.net.my 202.75.5.191Malaysia Malaysia
dns1.gitn.net.my 203.62.1.240Malaysia Malaysia

Doe.gov.my Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Doe.gov.my is a scam?