Dominacall24.de Website Information

Dominacall24.de has a Low Trust Score, a Statvoo Rank of I, an Alexa Rank of 6,228,131, a Majestic Rank of 0, a Domain Authority of 32% and is not listed in DMOZ.

Dominacall24.de is hosted by Neue Medien Muennich GmbH in Thuringen, Friedersdorf, Germany, 02742.
Dominacall24.de has an IP Address of 85.13.145.86 and a hostname of dd26318.kasserver.com.

The domain dominacall24.de was registered 201 decades 8 years 9 months ago by , it was last modified 5 years 1 week 3 days ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for dominacall24.de

Full Whois Lookup for Dominacall24.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: dominacall24.de
Nserver: ns5.kasserver.com
Nserver: ns6.kasserver.com
Status: connect
Changed: 2015-03-27T09:07:54+01:00

[Tech-C]
Type: PERSON
Name: Sebastian Mey
Organisation: KRiPPS medien & design
Address: Fritz-Koch-Strasse 3
PostalCode: 99817
City: Eisenach
CountryCode: DE
Phone: +49 151 17819771
Fax: +49
Email: Login to show email
2014-07-11T15:51:38+02:00

[Zone-C]
Type: PERSON
Name: Sebastian Mey
Organisation: KRiPPS medien & design
Address: Fritz-Koch-Strasse 3
PostalCode: 99817
City: Eisenach
CountryCode: DE
Phone: +49 151 17819771
Fax: +49
Email: Login to show email
2014-07-11T15:51:38+02:00

Who hosts Dominacall24.de?

Dominacall24.de Web Server Information

Hosted IP Address:85.13.145.86
Hosted Hostname:dd26318.kasserver.com
Service Provider:Neue Medien Muennich GmbH
Hosted Country:GermanyDE
Location Latitude:50.6049
Location Longitude:11.0358
Webserver Software:Not Applicable

HTTP Header Analysis for Dominacall24.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 04 Jun 2015 05:56:21 GMT
Server: Apache
P3P: CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM"
Expires: Mon, 1 Jan 2001 00:00:00 GMT
Last-Modified: Thu, 04 Jun 2015 05:56:22 GMT
Cache-Control: no-cache
Content-Encoding: gzip
X-Content-Encoded-By: Joomla! 2.5
Pragma: no-cache
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8


Need to find out who hosts Dominacall24.de?

Dominacall24.de Free SEO Report

Website Inpage Analysis for Dominacall24.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Dominacall24.de

mglichkeitzugangzugang zu allenmeinehauptsektionfrich bindeineneuedominacall24deknnensodominasaufvareinereigene fotogalerievergessenzu allenesprivate messagesmeinungsaustauschmessagesulmodtopmembersistvordes bdsmneustemalganzmitgliedersowohldiefreunde desaussexuellendassaustauschenneigungentreffpunkt frherrinnenbesonderennonefreunde des bdsmfetische und neigungen1michfealle dieeigeneclubhabentruesichichextremefindesklavennichtanderenewfunctionnhealle freundevorliebenknpfenimdie mglichkeitbenutzerprofilefotogalerieallesindfreundebenutzernametreffpunktbinzueinezu knnenuserhierumfangreiche benutzerprofilealle freunde desvondeinerdufr alleladymitanderendominafhrerfetischetelefonerziehungdirfotogalerienbdsmgstebuchfetischsklavinnenfreundeslistenpasswortdominacall24umfangreicheauchzugang zuhauptsektion fetischeallendominaalseinenerfahrungsli0deserfahrungs und meinungsaustauschdeinderwirdregistertreffpunkt fr alledichprivatedendeutschlanddasherrin

Longtail Keyword Density for Dominacall24.de

KeywordsOccurences
zugang zu allen3
fetische und neigungen3
erfahrungs- und meinungsaustausch3
freunde des bdsm3
alle freunde des3
treffpunkt fr alle3
umfangreiche benutzerprofile4
private messages4
zu knnen3
zu allen3
die mglichkeit3
ich bin3
hauptsektion fetische3
zugang zu3
eigene fotogalerie3
des bdsm3
freunde des3
fr alle3
alle die3
treffpunkt fr3
alle freunde3
dominas20
die20
der16
du14
zu13
domina11
auf11
ich10
bdsm9
das9
wird8
fetisch8
knnen8
den7
dominacall24de7
fr7
mit7
sich6
dir6
alle6
neue6
vergessen6
auch6
eine6
user5
dominafhrer5
meine5
sklaven5
dich5
true5
function5
vor5
var5
deine5
sklavinnen5
telefonerziehung5
bin5
hauptsektion5
mitglieder5
mich5
andere4
so4
passwort4
von4
fe4
nicht4
austauschen4
sind4
vorlieben4
es4
fotogalerien4
messages4
private4
ganz4
dominacall244
haben4
aus4
umfangreiche4
finde4
benutzerprofile4
li3
des3
neuste3
ulmodtopmembers3
03
freunde3
13
none3
extreme3
new3
hier3
herrin3
dein3
nhe3
mal3
einer3
dass3
fetische3
neigungen3
treffpunkt3
ist3
erfahrungs-3
meinungsaustausch3
besonderen3
sexuellen3
freundeslisten3
im3
als3
register3
allen3
fotogalerie3
eigene3
gstebuch3
lady3
mglichkeit3
herrinnen3
zugang3
einen3
anderen3
club3
knpfen3
sowohl3
deutschland3
deiner3
benutzername3

What are the nameservers for dominacall24.de?

Dominacall24.de Domain Nameserver Information

HostIP AddressCountry
ns5.kasserver.com 85.13.128.3Germany Germany
ns6.kasserver.com 85.13.159.101Germany Germany

Dominacall24.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Dominacall24.de is a scam?