Doorncontainers.nl Favicon Doorncontainers.nl

Doorncontainers.nl Website Thumbnail
Checking...
HOME - DR Depots Container Depot
Low trust score
Add a review Change category Claim this site
DR Depots is specialized in container repair, cleaning, storage and inspections of containers. With depots in Antwerp and Rotterdam, we have multiple possibilities for all your needs.


Domain summary

Domain label
doorncontainers
Domain extension
nl
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is doorncontainers.nl ranked relative to other sites:

Percentage of visits to doorncontainers.nl from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Doorncontainers.nl registered?
A: Doorncontainers.nl was registered 3 weeks, 4 days, 11 hours, 10 minutes, 50 seconds ago on Saturday, October 3, 2020.
Q: When was the WHOIS for Doorncontainers.nl last updated?
A: The WHOIS entry was last updated 3 weeks, 4 days, 11 hours, 10 minutes, 50 seconds ago on Saturday, October 3, 2020.
Q: What are Doorncontainers.nl's nameservers?
A: DNS for Doorncontainers.nl is provided by the following nameservers:
  • ns0-auth.businessconnect.nl
  • ns1-auth.businessconnect.eu
  • ns2-auth.businessconnect.net
Q: Who is the registrar for the Doorncontainers.nl domain?
A: The domain has been registered at Stichting Internet Domeinregistratie NL.
Q: What is the traffic rank for Doorncontainers.nl?
A: Doorncontainers.nl has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Doorncontainers.nl each day?
A: Doorncontainers.nl receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Doorncontainers.nl resolve to?
A: Doorncontainers.nl resolves to the IPv4 address 46.183.250.120.
Q: In what country are Doorncontainers.nl servers located in?
A: Doorncontainers.nl has servers located in the Netherlands.
Q: What webserver software does Doorncontainers.nl use?
A: Doorncontainers.nl is powered by Apache webserver.
Q: Who hosts Doorncontainers.nl?
A: Doorncontainers.nl is hosted by BusinessConnect B.V. in South Holland, Hoogvliet, Netherlands, 3194.
Q: How much is Doorncontainers.nl worth?
A: Doorncontainers.nl has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Doorncontainers.nl?

Doorncontainers.nl Hosting Provider Information

Hosted IP Address:46.183.250.120
Hosted Hostname:web20.businessconnect.nl
Service Provider:BusinessConnect B.V.
Hosted Country:NetherlandsNL
Location Latitude:51.8681
Location Longitude:4.3679
Webserver Software:Apache

Is "BusinessConnect B.V." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Doorncontainers.nl

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Sat, 03 Oct 2020 22:40:45 GMT
Server: Apache
Expires: Wed, 11 Jan 1984 05:00:00 GMT
Cache-Control: no-cache, must-revalidate, max-age=0
Pragma: no-cache
X-Redirect-By: WordPress
Upgrade: h2,h2c
Connection: Upgrade
Location: https://dr-depots.com/
Content-Length: 0
Content-Type: text/html; charset=UTF-8

Doorncontainers.nl Domain Nameserver Information

HostIP AddressCountry
ns0-auth.businessconnect.nl 46.183.250.54
ns1-auth.businessconnect.eu 176.74.234.74
ns2-auth.businessconnect.net 67.207.87.124


Need to find out who hosts Doorncontainers.nl?


WhoIs information for Doorncontainers.nl

 Domain name: doorncontainers.nl
Status: active

Registrar:
BusinessConnect B.V.
Hofdreef 42
4881DR ZUNDERT
Netherlands

Abuse Login to show email
Date: 1999-02-02

Updated Date: 2018-08-17

DNSSEC: yes

Domain nameservers:
ns0-auth.businessconnect.nl
ns1-auth.businessconnect.eu
ns2-auth.businessconnect.net

Record maintained by: NL Domain Registry

Copyright notice
No part of this publication may be reproduced, published, stored in a
retrieval system, or transmitted, in any form or by any means,
electronic, mechanical, recording, or otherwise, without prior
permission of the Foundation for Internet Domain Registration in the
Netherlands (SIDN).
These restrictions apply equally to registrars, except in that
reproductions and publications are permitted insofar as they are
reasonable, necessary and solely in the context of the registration
activities referred to in the General Terms and Conditions for .nl
Registrars.
Any use of this material for advertising, targeting commercial offers or
similar activities is explicitly forbidden and liable to result in legal
action. Anyone who is aware or suspects that such activities are taking
place is asked to inform the Foundation for Internet Domain Registration
in the Netherlands.
(c) The Foundation for Internet Domain Registration in the Netherlands
(SIDN) Dutch Copyright Act, protection of authors' rights (Section 10,
subsection 1, clause 1).

Doorncontainers.nl Free SEO Report

Website Inpage Analysis for Doorncontainers.nl

H1 Headings

0 :

H2 Headings

9 :
  1. We are one of the leading operators in the field of empty container storage in Rotterdam and
  2. Antwerp
  3. Our Main Services
  4. Container Storage
  5. Pre-trip inspections
  6. Container Cleaning
  7. Container Repair
  8. e-Services: We offer a permanent overview of the depot stock and container locations. Click below to login!
  9. Member of D&R Group

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

3 :

Total Images

29 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-87070719-14

Links - Internal

8:
  1. Container Storage
    http://doorncontainers.nl/services/#ContainerStorage
  2. Learn More
    http://doorncontainers.nl/services/#ContainerStorage
  3. Pre-trip inspections
    http://doorncontainers.nl/services/#Pre-Trip-Inspections
  4. Learn More
    http://doorncontainers.nl/services/#Pre-Trip-Inspections
  5. Container Cleaning
    http://doorncontainers.nl/services/#Container-Cleaning
  6. Learn More
    http://doorncontainers.nl/services/#Container-Cleaning
  7. Container Repair
    http://doorncontainers.nl/services/#Container-Repair
  8. Learn More
    http://doorncontainers.nl/services/#Container-Repair

Links - Internal (nofollow)

0:

Links - Outbound

31:
  1. Facebook
    https://www.facebook.com/drdepots/
  2. No text
    https://dr-depots.com/
  3. HOME
    https://dr-depots.com/
  4. ABOUT
    https://dr-depots.com/about-dr-depots/
  5. SERVICES
    https://dr-depots.com/services/
  6. e-SERVICES
    https://dr-depots.com/e-services/
  7. PUBLIC RELATIONS
    https://dr-depots.com/public-relations/
  8. CAREER
    https://jobs.dr-group.nl/vacatures/?company=DRDEPOTS
  9. CONTACT
    https://dr-depots.com/contact/
  10. CONTACT Rotterdam
    https://dr-depots.com/contact-rotterdam/
  11. CONTACT Antwerp
    https://dr-depots.com/contact-antwerpen/
  12. LINKS
    https://dr-depots.com/links/
  13. ABOUT DR DEPOTS
    https://dr-depots.com/about-dr-depots/
  14. Rotterdam
    https://dr-depots.com/contact-rotterdam/
  15. Antwerp
    https://dr-depots.com/contact-antwerpen/
  16. DR Depots
    https://dr-depots.com/blog/author/carli-wessels/
  17. Rotterdam
    https://ttnl.dr-depots.com/
  18. Antwerp
    https://ttbe.dr-depots.com/
  19. No text
    http://distrirail.nl/
  20. No text
    http://www.kgn-measurement.nl/
  21. No text
    http://www.rotterdamoverseas.net/
  22. No text
    http://www.eurobusinesspartners.nl/
  23. No text
    http://www.dutchroadrotterdam.nl/
  24. No text
    http://www.vandongederoo.com/
  25. No text
    http://www.srmarine.nl/
  26. No text
    http://www.cross-limits.com/
  27. No text
    http://www.xtrades.nl
  28. No text
    https://www.dr-depots.com
  29. Van Donge & de Roo
    http://www.vandongederoo.com
  30. Rotterdam
    https://dr-depots.com/wp-content/uploads/2019/04/DR-Depots-algemene-voorwaarden.pdf
  31. Antwerp
    https://dr-depots.com/wp-content/uploads/2019/04/DR-Depots-algemene-voorwaarden.pdf

Links - Outbound (nofollow)

0:

Keyword Cloud for Doorncontainers.nl

elsehtmldivinnerhtml htmldivcss elsehtmldivinnerhtmllinkarealinkiconhoverlinkareaboxhtmldivinnerhtml htmldivinnerhtmlff6c00linkareaboxhoverlinkareaboxicircleyes fusioncontentboxes1fusioncontentboxes1 fusioncontentboxhover linkarealinkiconhoverlinkareaboxfunctionfusioncontentboxhover linkarealinkiconhover headingvar htmldivfusioncontentboxhover linkarealinkiconhoverlinkareaboxhtmldivlinkareaboxhover headingcontentboxheading fusioncontentboxes1 fusioncontentboxhoverhtmldiv documentcreateelementdivourheadinglinkicircleyesantwerpvar htmldiv documentgetelementbyidrspluginsettingsinlinecssff6c00 importantifhtmldiv htmldivinnerhtmldocumentcreateelementdivcontainerunitsheadingendusfusioncontentboxhoverfusioncontentboxhover linkareaboxhoverheading iconincludeelse varfusioncontentboxes1 fusioncontentboxhoverdocumentcreateelementdiv htmldivinnerhtml htmldivcssicon icircleyesheading contentboxheadingifhtmldiv htmldivinnerhtml htmldivinnerhtmlfusioncontentboxhover linkareaboxhoverlinkareaboxjqueryhtmldivcss else varhtmldivcsslinkarealinkiconhover headinghtmldivinnerhtml htmldivcsslinkarealinkiconhoverhtmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0fusioncontentboxhover linkarealinkiconhovervar htmldiv documentcreateelementdivfusioncontentboxes1 fusioncontentboxhover linkarealinkiconhoverhtmldiv documentgetelementbyidrspluginsettingsinlinecsswelearndocumentcreateelementdiv htmldivinnerhtmlicircleyes fusioncontentboxes1 fusioncontentboxhovervarhtmldiv documentcreateelementdiv htmldivinnerhtmlicon icircleyes fusioncontentboxes1var htmldivcssfusioncontentboxes1 fusioncontentboxhover linkareaboxhoverrevolutionfusioncontentboxes1rotterdamslidercontentboxheading fusioncontentboxes1htmldivcss elsehtmldivinnerhtml htmldivinnerhtml htmldivcssfusioncontentboxes1 fusioncontentboxhover linkareaboxhoverlinkareaboxifimportanterrormessagedocumentgetelementsbytagnamehead0appendchildhtmldivchildnodes0storagefusioncontentboxhover linkareaboxhover headingcolorlinkareaboxhoverifhtmldiviconcontentboxheadingelse var htmldivhtmldivinnerhtml htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0documentgetelementbyidrspluginsettingsinlinecss

Longtail Keyword Density for Doorncontainers.nl

KeywordsOccurences
fusion-content-boxes-1 fusion-content-box-hover link-area-box-hover5
fusion-content-boxes-1 fusion-content-box-hover link-area-link-icon-hover5
fusion-content-box-hover link-area-box-hover heading4
content-box-heading fusion-content-boxes-1 fusion-content-box-hover4
fusion-content-box-hover link-area-link-icon-hover heading4
var htmldiv documentgetelementbyidrs-plugin-settings-inline-css3
icon icircle-yes fusion-content-boxes-13
fusion-content-boxes-1 fusion-content-box-hover link-area-box-hoverlink-area-box3
fusion-content-boxes-1 fusion-content-box-hover link-area-link-icon-hoverlink-area-box3
htmldivinnerhtml htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes03
ifhtmldiv htmldivinnerhtml htmldivinnerhtml3
documentcreateelementdiv htmldivinnerhtml htmldivcss3
htmldiv documentcreateelementdiv htmldivinnerhtml3
var htmldiv documentcreateelementdiv3
else var htmldiv3
htmldivcss else var3
htmldivinnerhtml htmldivcss else3
htmldivinnerhtml htmldivinnerhtml htmldivcss3
icircle-yes fusion-content-boxes-1 fusion-content-box-hover3
fusion-content-boxes-1 fusion-content-box-hover22
htmldivinnerhtml htmldivcss6
var htmldiv6
fusion-content-box-hover link-area-link-icon-hover5
ff6c00 important5
fusion-content-box-hover link-area-box-hover5
link-area-link-icon-hover heading4
icon icircle-yes4
heading icon4
link-area-box-hover heading4
content-box-heading fusion-content-boxes-14
fusion-content-box-hover link-area-box-hoverlink-area-box3
fusion-content-box-hover link-area-link-icon-hoverlink-area-box3
ifhtmldiv htmldivinnerhtml3
htmldivinnerhtml htmldivinnerhtml3
htmldiv documentgetelementbyidrs-plugin-settings-inline-css3
heading content-box-heading3
htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes03
documentcreateelementdiv htmldivinnerhtml3
htmldiv documentcreateelementdiv3
else var3
htmldivcss else3
var htmldivcss3
icircle-yes fusion-content-boxes-13
fusion-content-boxes-124
fusion-content-box-hover23
var12
heading10
htmldivcss9
htmldivinnerhtml9
icon8
function7
ff6c006
errormessage6
content-box-heading6
htmldiv6
else5
link-area-link-icon-hover5
important5
link-area-box-hover5
antwerp4
our4
rotterdam4
container4
learn4
jquery4
if4
icircle-yes4
storage4
revolution3
slider3
color3
us3
link-area-box-hoverlink-area-box3
link-area-link-icon-hoverlink-area-box3
heading-link3
we3
units3
end3
documentgetelementsbytagnamehead0appendchildhtmldivchildnodes03
documentcreateelementdiv3
ifhtmldiv3
documentgetelementbyidrs-plugin-settings-inline-css3
include3

Doorncontainers.nl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Doorna.com
Wellnesszap.com
Doornbos.com
Doornbos Heating and Air Conditioning | HVAC Contractor | Orland Park, IL
Doorncontainers.nl
HOME - DR Depots Container Depot
Doornekampmotorsport.nl
Motorzaak in Hoevelaken | Doornekamp Motorsport
Doornenbal.org
XERUS Default Page: It works
Doornewyork.com
502 Bad Gateway
Doorngift.com
403 Forbidden

Recently Updated Websites

Bustersimpson.net 4 seconds ago.Hagnotig.com 5 seconds ago.Rochesterlivewire.com 5 seconds ago.Kreative-strukturen.de 5 seconds ago.Poseyogastudio.com 8 seconds ago.Abogadosasesoresalianza.com 8 seconds ago.Delwawa.com 8 seconds ago.Triple-it.nl 8 seconds ago.Pvzshka.com 9 seconds ago.Lawyerlee.com 9 seconds ago.Techsoware.com 10 seconds ago.Fmf66.com 10 seconds ago.Techosdetejas.com 10 seconds ago.Verifiedtipsters.com 10 seconds ago.Drawstickers.com 11 seconds ago.Knifefellas.com 11 seconds ago.Banglafreeebook.blogspot.com 11 seconds ago.Adanprasla.com 12 seconds ago.Usef.org 12 seconds ago.Lifebloodnigeria.org 13 seconds ago.Theflowerchoice.net 13 seconds ago.Connectionskate.com 13 seconds ago.Chatiraqnaa.net 13 seconds ago.Furu310.com 14 seconds ago.Transfrired.com 14 seconds ago.Popsockets.com 14 seconds ago.Alternativetheatreco.org 14 seconds ago.Tribaltinyhouse.com 15 seconds ago.1sunmoon.com 16 seconds ago.Fivefingersformarseilles.com 16 seconds ago.