Dptv.org

Checking...
Detroit Public TV – WTVS – Detroit's PBS Station
Low trust score
 | 
Add a review Change category Claim this site
WTVS - Detroit's PBS Station


Domain summary

Domain label
dptv
Domain extension
org
Domain registered:
1998-10-14
Domain updated:
2020-09-08
Global Traffic Rank
339,426
Statvoo Rating
G
Trust Score
Low Trust Score
Estimated worth
$27,540
Estimated daily income
$51
Estimated monthly income
$1,551

Rank summary

How is dptv.org ranked relative to other sites:

Percentage of visits to dptv.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Dptv.org registered?
A: Dptv.org was registered 21 years, 11 months, 1 week, 3 days, 12 hours, 43 minutes, 12 seconds ago on Wednesday, October 14, 1998.
Q: When was the WHOIS for Dptv.org last updated?
A: The WHOIS entry was last updated 2 weeks, 2 days, 12 hours, 43 minutes, 12 seconds ago on Tuesday, September 8, 2020.
Q: What are Dptv.org's nameservers?
A: DNS for Dptv.org is provided by the following nameservers:
  • pete.ns.cloudflare.com
  • dahlia.ns.cloudflare.com
Q: Who is the registrar for the Dptv.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Dptv.org?
A: Dptv.org ranks 339,426 globally on Alexa. Dptv.org has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit Dptv.org each day?
A: Dptv.org receives approximately 4,537 visitors and 18,148 page impressions per day.
Q: What IP address does Dptv.org resolve to?
A: Dptv.org resolves to the IPv4 address 18.213.183.6.
Q: In what country are Dptv.org servers located in?
A: Dptv.org has servers located in the United States.
Q: What webserver software does Dptv.org use?
A: Dptv.org is powered by Apache webserver.
Q: Who hosts Dptv.org?
A: Dptv.org is hosted by T-mobile Netherlands bv. in Virginia, Ashburn, United States, 20149.
Q: How much is Dptv.org worth?
A: Dptv.org has an estimated worth of $27,540. An average daily income of approximately $51, which is roughly $1,551 per month.

Who hosts Dptv.org?

Dptv.org Hosting Provider Information

Hosted IP Address:18.213.183.6
Hosted Hostname:ec2-18-213-183-6.compute-1.amazonaws.com
Service Provider:T-mobile Netherlands bv.
Hosted Country:United StatesUS
Location Latitude:39.0481
Location Longitude:-77.4729
Webserver Software:Apache

Is "T-mobile Netherlands bv." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Dptv.org

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Tue, 08 Sep 2020 02:47:08 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 0
Connection: keep-alive
Server: Apache
Vary: Accept-Encoding
Expires: Tue, 08 Sep 2020 03:47:08 GMT
Cache-Control: max-age=3600
X-Redirect-By: redirection
Location: https://www.dptv.org/

Dptv.org Domain Nameserver Information

HostIP AddressCountry
pete.ns.cloudflare.com 172.64.33.136
dahlia.ns.cloudflare.com 173.245.58.89


Need to find out who hosts Dptv.org?


WhoIs information for Dptv.org

 Domain Name: DPTV.ORG
Registry Domain ID: D2191701-LROR
Registrar WHOIS Server: whois.cloudflare.com
Registrar URL: http://www.cloudflare.com
Updated Date: 2020-01-12T00:21:51Z
Creation Date: 1998-10-14T04:00:00Z
Registry Expiry Date: 2023-10-13T04:00:00Z
Registrar Registration Expiration Date:
Registrar: CloudFlare, Inc.
Registrar IANA ID: 1910
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.6503198930
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: DATA REDACTED
Registrant State/Province: DATA REDACTED
Registrant Country: US
Name Server: PETE.NS.CLOUDFLARE.COM
Name Server: DAHLIA.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-09-08T02:46:09Z

Dptv.org Free SEO Report

Website Inpage Analysis for Dptv.org

H1 Headings

0 :

H2 Headings

1 :
  1. Coping with the COVID-19 Crisis | One Detroit

H3 Headings

24 :
  1. Features
  2. MPC20 Conversations: Respond and Rebuild
  3. At-home Learning
  4. National Programs
  5. Local Programs
  6. Latest News
  7. DPTV Passport
  8. What's On
  9. Public Media Funding
  10. Channels
  11. Main Channel
  12. Detroit PBS KIDS
  13. Create
  14. The WORLD Channel
  15. Features
  16. Bright By Text
  17. Detroit PBS KIDS Live TV
  18. DPTV Mobile App
  19. PBS Books
  20. CAMP TV
  21. Programs
  22. Detroit PBS KIDS
  23. Support DPTV
  24. About Us

H4 Headings

3 :
  1. Become a member
  2. Join Passport
  3. Events & Tickets

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

46 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-6058785-1

Links - Internal

128:
  1. Home
    https://www.dptv.org/
  2. Schedule
    https://www.dptv.org/schedule/
  3. About
    https://www.dptv.org/about/
  4. About Detroit Public TV
    https://www.dptv.org/about/
  5. Mission, Vision and Values
    https://www.dptv.org/about/mission-vision-values/
  6. Leadership
    https://www.dptv.org/about/leadership/
  7. Annual Report
    https://www.dptv.org/about/annual-report/
  8. Careers
    https://www.dptv.org/about/careers/
  9. Legal Notices & Public Filings
    https://www.dptv.org/about/legal-notices-and-public-filings/
  10. Media
    https://www.dptv.org/about/media/
  11. Frequently Asked Questions
    https://www.dptv.org/about/frequently-asked-questions/
  12. Community Advisory Panel
    https://www.dptv.org/about/community-advisory-panel/
  13. Contact
    https://www.dptv.org/about/contact/
  14. Events
    https://www.dptv.org/about/media/detroit-public-tv-and-wrcj-responds-to-coronavirus-emergency/
  15. Video
    https://video.dptv.org/
  16. Live TV
    https://www.dptv.org/livetv/
  17. DPTV’s Mobile App
    https://www.dptv.org/about/mobile-app/
  18. Programs
    https://video.dptv.org/shows/?search=&genre=all-genres&source=all-sources&sortBy=popular&stationId=7f382f2c-72eb-4e19-ba1b-1d6d143ae841
  19. Arts & Culture
    https://www.dptv.org/programs/arts-culture/
  20. Children & Education
    https://www.dptv.org/education/
  21. Journalism
    https://www.dptv.org/programs/leadership-public-affairs/
  22. Energy & The Environment
    https://www.dptv.org/programs/energy-environment/
  23. Documentaries
    https://www.dptv.org/programs/documentaries/
  24. Support
    https://www.dptv.org/support/
  25. Donate
    https://be.dptv.org/donate/index.html?cmpgn=menu
  26. Volunteer
    https://www.dptv.org/support/volunteer/
  27. Other Ways to Give
    http://dptv.org/support#other
  28. Matching Gift Companies
    https://www.dptv.org/support/matching/
  29. Legacy Leaders
    http://specials.dptv.org/planned-giving?cmpgn=menu
  30. Society for Excellence
    https://www.dptv.org/support/society-excellence/
  31. Smith Leadership Circle
    https://www.dptv.org/support/smith-leadership-circle/
  32. Corporate Sponsorship
    https://www.dptv.org/support/corporate-sponsorship/
  33. Education
    https://www.dptv.org/education/
  34. Education Home
    https://www.dptv.org/education/
  35. New TV Programming Resources & Schedule
    https://www.dptv.org/education/tv-programming-resources/
  36. Detroit PBS Kids | Virtual Camps for Kids
    https://www.dptv.org/detroit-pbs-kids-virtual-camps-for-kids/
  37. Parents & Caregivers
    https://www.dptv.org/education/parents-caregivers/
  38. Educators
    https://www.dptv.org/education/educators/
  39. Silent Heroes
    https://www.dptv.org/education/silent-heroes/
  40. In the Community
    http://dptv.org/education/community
  41. Video
    https://www.dptv.org/education/detroit-pbs-kids-video-content/
  42. Awards
    https://www.dptv.org/education/awards/
  43. Kids
    https://www.dptv.org/kids/
  44. Kids Schedule
    https://www.dptv.org/kids/kids-schedule/
  45. Kids Live Stream & Video
    https://www.dptv.org/kids/kids-video/live-stream/
  46. Detroit PBS KIDS Club Live
    https://www.dptv.org/kids/kids-club-live/
  47. Talking to Your Kids About Coronavirus
    https://www.dptv.org/education/talking-to-your-kids-about-coronavirus/
  48. No text
    https://www.dptv.org/
  49. No text
    http://dptv.org/about/enews
  50. No text
    http://dptv.org/home?cmpgn=mobilehdr
  51. LIVE TV
    http://dptv.org/livetv?cmpgn=mobilehdr
  52. DONATE
    https://be.dptv.org/donate/index.html?cmpgn=MOBDN
  53. No text
    https://be.dptv.org/donate/index.html?cmpgn=DTDN
  54. No text
    http://dptv.org/about/enews?cmpgn=DN
  55. LIVE TV
    https://www.dptv.org/livetv/?cmpgn=urhc
  56. No text
    https://www.dptv.org/2020/detroit-jazz-festival-presented-by-rocket-mortgage/
  57. WATCH LIVE
    https://www.dptv.org/2020/detroit-jazz-festival-presented-by-rocket-mortgage/
  58. Get DPTV Passport
    http://www.dptv.org/support/dptv-passport/?cmpgn=dptvhp
  59. Learn More
    http://dptv.org/support/corporate-sponsorship
  60. No text
    http://dptv.org/education/resource-list
  61. At-home Learning
    http://dptv.org/education/resource-list
  62. Sign-up for the weekly newsletter
    https://www.dptv.org/education/resource-list/#newsletters
  63. View Resources
    https://www.dptv.org/education/resource-list/
  64. No text
    https://video.dptv.org/show/american-masters/?cmpgn=imgcar
  65. No text
    https://www.dptv.org/programs/antiques-roadshow/?cmpgn=imgcar
  66. No text
    https://video.dptv.org/show/frontline/?cmpgn=imgcar
  67. No text
    https://video.dptv.org/franchise/masterpiece/?cmpgn=imgcar
  68. No text
    https://video.dptv.org/show/nature/?cmpgn=imgcar
  69. No text
    https://video.dptv.org/show/nova/?cmpgn=imgcar
  70. No text
    https://video.dptv.org/show/newshour/?cmpgn=imgcar
  71. No text
    https://www.dptv.org/programs/this-old-house/?cmpgn=imgcar
  72. No text
    http://dptv.org/programs/under-radar-michigan/?cmpgn=imgcar
  73. No text
    http://dptv.org/support/passport/?cmpgn=supportrr
  74. Sign-in
    https://video.dptv.org/?showSignIn=true&returnURL=/
  75. Learn More
    http://dptv.org/support/corporate-sponsorship/
  76. No text
    http://dptv.org/schedule?dptvhpchannel
  77. Main Channel
    http://dptv.org/schedule?cmpgn=mainchanneltxt
  78. View Schedule
    http://dptv.org/schedule?dptvhpchanneltxt
  79. No text
    http://dptv.org/kids/kids-schedule/?dptvhpchannelimg
  80. Detroit PBS KIDS
    http://dptv.org/kids/kids-schedule/?cmpgn=kidshpchannels
  81. View Kids Schedule
    http://dptv.org/kids/kids-schedule/?cmpgn=kidshpchannels
  82. No text
    http://dptv.org/create
  83. Create
    http://dptv.org/create?dptvhpchanneltxt
  84. View Create Schedule
    http://dptv.org/create?dptvhpchanneltxt
  85. No text
    http://dptv.org/world
  86. The WORLD Channel
    http://dptv.org/world?cmpgn=dptvhptext
  87. View WORLD Schedule
    http://dptv.org/world?cmpgn=dptvhptext
  88. No text
    https://www.dptv.org/kids/bright-by-text/
  89. Bright By Text
    https://www.dptv.org/kids/bright-by-text/
  90. Learn More
    http://dptv.org/kids/bright-by-text
  91. No text
    http://dptv.org/kids/kids-video/?cmpgn=dptvhp
  92. Detroit PBS KIDS Live TV
    http://dptv.org/kids/kids-video/?cmpgn=dptvhp
  93. Watch Now
    http://dptv.org/kids/kids-video/?cmpgn=dptvhp
  94. No text
    http://dptv.org/about/mobile-app
  95. DPTV Mobile App
    http://dptv.org/about/mobile-app/
  96. Download Now
    http://dptv.org/about/mobile-app
  97. Programs
    https://video.dptv.org/shows/?genre=All&station=wtvs&layout=grid&cmpgn=Pgms-ftr
  98. TV Schedule
    http://dptv.org/schedule?cmpgn=ftr
  99. Programs A to Z
    https://video.dptv.org/shows/?genre=All&title=&station=wtvs&alphabetically=true&layout=grid?cmpgn=ftr
  100. Under the Radar Michigan
    https://video.dptv.org/show/under-radar/?cmpgn=ftr
  101. Detroit PBS KIDS
    http://dptv.org/education?cmpgn=ftr
  102. Education Home
    http://dptv.org/education/?cmpgn=ftr
  103. Kids Home
    http://dptv.org/kids/?cmpgn=ftr
  104. Resources
    http://dptv.org/education/resource-list?cmpgn=ftr
  105. Register
    http://dptv.org/education/resource-list#newsletters
  106. Kids Schedule
    http://dptv.org/kids/kids-schedule/?cmpgn=ftr
  107. Video
    http://dptv.org/kids/kids-video?cmpgn=ftr
  108. Support DPTV
    http://dptv.org/support/?cmpgn=ftr
  109. Membership
    https://be.dptv.org/donate/index.html?cmpgn=ftr
  110. Monthly Giving
    https://be.dptv.org/sustainer/?cmpgn=ftr
  111. DPTV Passport
    http://dptv.org/support/dptv-passport/?cmpgn=ftr
  112. Legacy Leaders
    https://specials.dptv.org/planned-giving/?cmpgn=ftr
  113. Other Ways of Giving
    http://dptv.org/support?cmpgn=ftr
  114. Volunteer
    http://dptv.org/support/volunteer?cmpgn=ftr
  115. About Us
    http://dptv.org/about?cmpgn=ftr
  116. Mission
    https://www.dptv.org/about/mission-vision-values/?cmpgn=ftr
  117. Leadership
    http://dptv.org/about/leadership/?cmpgn=ftr
  118. Annual Report
    http://dptv.org/about/annual-report?cmpgn=ftr
  119. Sign-up
    http://dptv.org/about/enews?cmpgn=ftr
  120. Careers
    http://dptv.org/about/careers?cmpgn=ftr
  121. FCC Public Inspection File
    http://dptv.org/about/fcc-public-inspection-files/?cmpgn=ftr
  122. Privacy Policy
    http://dptv.org/about/privacy-policy
  123. Donor Privacy Policy
    http://dptv.org/about/donor-privacy-policy/
  124. Terms of Use
    http://dptv.org/about/terms-of-use/
  125. Legal Notices
    http://dptv.org/about/legal/
  126. Contact
    http://dptv.org/about/contact
  127. Sign-up
    http://dptv.org/about/enews
  128. DPTV.org
    https://www.dptv.org/

Links - Internal (nofollow)

0:

Links - Outbound

50:
  1. Local Content & Service Report
    https://d2llftavlule1q.cloudfront.net/wp-content/uploads/2020/02/DPTV-WRCJ-LocalContentServiceReport2019.pdf
  2. DPTV’s YouTube Channel
    https://www.youtube.com/user/detroitpublictv
  3. Other PBS Apps
    https://www.pbs.org/pbs-video-app/
  4. Update Credit Card
    https://www.callswithoutwalls.com/pledgeCart3/?campaign=9F22865F-6298-4292-B636-9DEB02B3B2FA&source=#/home?cmpgn=mainpnav
  5. No text
    https://www.facebook.com/detroitpublictv/
  6. No text
    https://twitter.com/detroitpublictv
  7. No text
    https://www.youtube.com/detroitpublictv
  8. No text
    https://www.flickr.com/photos/dptvphotos/albums
  9. No text
    https://www.linkedin.com/company/detroit-public-television/
  10. No text
    https://www.instagram.com/detroitpublictv/
  11. No text
    https://www.callswithoutwalls.com/pledgeCart3/?campaign=DAA1C44D-F227-4112-B7FF-9EFE9915AFB3&source=#/home?cmpgn=slider
  12. GIVE NOW
    https://www.callswithoutwalls.com/pledgeCart3/?campaign=DAA1C44D-F227-4112-B7FF-9EFE9915AFB3&source=#/home?cmpgn=slider
  13. No text
    https://www.detroitjazzfest.org/
  14. No text
    https://onedetroitpbs.org
  15. Mondays at 7:30p
    https://www.onedetroitpbs.org/
  16. WATCH NOW
    https://www.onedetroitpbs.org/8-17-20-one-detroit-nate-wallace-seven-last-words-of-the-unarmed-hannah-lydia-wilson-axd/
  17. VIEW THANK YOU GIFTS
    https://www.callswithoutwalls.com/pledgeCart3/?campaign=DAA1C44D-F227-4112-B7FF-9EFE9915AFB3&source=#/home?cmpgn=sliderSUZE
  18. View Thank You Gifts
    https://www.callswithoutwalls.com/pledgeCart3/?campaign=DAA1C44D-F227-4112-B7FF-9EFE9915AFB3&source=#/home?cmpgn=urhcdonate
  19. View Available Tickets
    https://www.callswithoutwalls.com/pledgeCart3/?campaign=63F5A385-9358-4762-8EB9-5CFD2F9BAA67&source=#/home?cmpgn=urhcdonate
  20. Coping with the COVID-19 Crisis | One Detroit
    https://www.onedetroitpbs.org/
  21. No text
    https://www.onedetroitpbs.org/student-reporting-labs/
  22. Returning to School: Students’ Hopes & Concerns
    https://www.onedetroitpbs.org/student-reporting-labs/
  23. No text
    https://www.onedetroitpbs.org/mackinac-mpc20-conversations-respond-and-rebuild/
  24. MPC20 Conversations: Respond and Rebuild
    https://www.onedetroitpbs.org/mackinac-mpc20-conversations-respond-and-rebuild/
  25. Learn More
    https://www.onedetroitpbs.org/mackinac-mpc20-conversations-respond-and-rebuild/
  26. No text
    https://www.onedetroitpbs.org/?cmpgn=imgcar
  27. No text
    https://www.greatlakesnow.org/?cmpgn=imgcar
  28. No text
    https://www.onedetroitpbs.org/category/american-black-journal/?cmpgn=imgcar
  29. No text
    https://www.detroitperforms.org/?cmpgn=imgcar
  30. No text
    https://www.greatlakesnow.org/2020/09/great-lakes-moment-uniroyal-contaminated-sediment-cleanup/
  31. Great Lakes Moment: Cleanup of contaminated river sediment begins at old Uniroyal site
    https://www.greatlakesnow.org/2020/09/great-lakes-moment-uniroyal-contaminated-sediment-cleanup/
  32. No text
    https://www.greatlakesnow.org/2020/09/great-lakes-author-conflict-culture-novel/
  33. The Best Part of Us: Great Lakes author tackles conflict and culture in new novel
    https://www.greatlakesnow.org/2020/09/great-lakes-author-conflict-culture-novel/
  34. No text
    https://www.onedetroitpbs.org/9-3-20-one-detroit-student-reporting-labs-covering-protests-against-police-brutality-pandemic-in-detroit-detroit-jazz-city/
  35. 9/3/20: One Detroit – Student Reporting Labs / Covering Protests Against Police Brutality / Pandemic in Detroit / Detroit Jazz City
    https://www.onedetroitpbs.org/9-3-20-one-detroit-student-reporting-labs-covering-protests-against-police-brutality-pandemic-in-detroit-detroit-jazz-city/
  36. No text
    https://www.wrcjfm.org/listen-live/?cmpgn=dptvhp
  37. No text
    https://protectmypublicmedia.org/
  38. No text
    https://www.pbsbooks.org/?cmpgn=dptvhp
  39. PBS Books
    https://www.pbsbooks.org/?dptv
  40. Learn More
    https://www.pbsbooks.org
  41. No text
    https://www.thirteen.org/programs/camp-tv/
  42. CAMP TV
    https://www.thirteen.org/programs/camp-tv/
  43. Learn More
    https://www.thirteen.org/programs/camp-tv/
  44. American Black Journal
    http://www.onedetroitpbs.org/category/american-black-journal?cmpgn=ftr
  45. Detroit Performs
    https://www.detroitperforms.org/?cmpgn=ftr
  46. Great Lakes Now
    https://www.greatlakesnow.org/?cmpgn=ftr
  47. One Detroit
    http://www.onedetroitpbs.org?cmpgn=ftr
  48. View Thank You Gifts
    https://www.callswithoutwalls.com/pledgeCart3/?campaign=DAA1C44D-F227-4112-B7FF-9EFE9915AFB3&source=#/home?cmpgn=ThankYouGifts?cmpgn=ftr
  49. Update Credit Card
    https://www.callswithoutwalls.com/pledgeCart3/?campaign=9F22865F-6298-4292-B636-9DEB02B3B2FA&source=#/home?cmpgn=ftr?cmpgn=ftr
  50. wrcjfm.org
    https://www.wrcjfm.org

Links - Outbound (nofollow)

2:
  1. No text
    https://www.onedetroitpbs.org/student-reporting-labs/
  2. Returning to School: Students’ Hopes & Concerns
    https://www.onedetroitpbs.org/student-reporting-labs/

Keyword Cloud for Dptv.org

kids virtual campsboxshadow noneborderwidthpbs20px 20px boxshadowschedulebordercolor rgba2552552551borderradius0pxdivn2ss4learn20px 20pxthankkids livepublic tvdetroit public tvnoneborderwidth 0pxborderstylenonefontweighteducation1890d7fontsize100textshadowpbs kidssupportfreefavoriteonelakesnormaltextdecoration nonetextalignn2ssslider3appnextendarrowanimatedverticalkids virtualdetroitgreatwindowgoogletagnormaltexttransform nonefontweight 400divn2ss4solidbordercolor ffffff bordercolorleadershipplaceholder20px1890d7fontsize100textshadow nonelineheight 15fontweightvirtual20px 20px 20pxrgba2552552551borderradius0pxdivn2ss4normalwordspacing20px boxshadowlocaln2activedivn2ss4divdivn2ss4learn morepassportkids scheduleffffff bordercolorlive15fontweightone detroitpartdetroit publictruevargreat lakes nowyourffffff bordercolor rgba2552552551borderradius0pxdivn2ss4newsprogrammingnormaltexttransformyounonetextalign leftletterspacing normalwordspacing1890d7fontsize100textshadow nonelineheightnormalfontstyle normaltextdecorationschedule detroit15fontweight normalfontstyleprogramsrobotoarialcolorvideolive tvdptv passportgreat lakesboxshadow noneborderwidth 0pxborderstylelakes nowcreditvirtual campsnormalwordspacing normaltexttransform nonefontweight0px 0pxnonelineheightmoreresourcesdetroit pbs kidsnonelineheight 15fontweightnormaltexttransform nonefontweightusmobilebordercolorn2fontb186d6f1bd16dbdbfe32a36fc13ed5a9paragraphrobotoarialcolor 1890d7fontsize100textshadow nonelineheightmobile appsignupothernoneborderwidthn2fontf1873f98e45041c78bf73ffc77c7db41paragraphhomecontentnormalwordspacing normaltexttransformyour favorite0watchread nowleftletterspacing normalwordspacing normaltexttransformsolidbordercolor ffffffnoneborderwidth 0pxborderstyle solidbordercolortvpublicleftletterspacingn2ssbuttoncontainerleftletterspacing normalwordspacing2divn2ss4nonetextalign0pxborderstyle solidbordercolor15fontweight normalfontstyle normaltextdecorationnormalfontstyle normaltextdecoration nonetextalignnonetextalign leftletterspacingboxshadownormaltextdecoration300 250learningrobotoarialcolor 1890d7fontsize100textshadow0pxborderstyle solidbordercolor ffffffpolicynotices0380pxborderstyleffffffwaysviewcampschannelthank younonelineheight 15fontweight normalfontstyleshowspbs kids virtual400divn2ss4kidsnewreadjazzseptember0pxnownormaltextdecoration nonetextalign leftletterspacingdptvarts1nonefontweight 400divn2ss4featuresvarchildrengoogletagcmdpushfunctionnormalfontstyleschedule detroit pbsdetroit pbssolidbordercolorreport20px boxshadow noneborderwidth

Longtail Keyword Density for Dptv.org

KeywordsOccurences
detroit pbs kids9
nonetext-align leftletter-spacing normalword-spacing8
normalword-spacing normaltext-transform nonefont-weight8
leftletter-spacing normalword-spacing normaltext-transform8
noneline-height 15font-weight normalfont-style8
15font-weight normalfont-style normaltext-decoration8
normalfont-style normaltext-decoration nonetext-align8
normaltext-decoration nonetext-align leftletter-spacing8
detroit public tv6
normaltext-transform nonefont-weight 400divn2-ss-46
noneborder-width 0pxborder-style solidborder-color5
box-shadow noneborder-width 0pxborder-style5
kids virtual camps4
pbs kids virtual4
robotoarialcolor 1890d7font-size100text-shadow noneline-height4
1890d7font-size100text-shadow noneline-height 15font-weight4
0pxborder-style solidborder-color ffffff4
solidborder-color ffffff border-color4
great lakes now4
schedule detroit pbs3
ffffff border-color rgba2552552551border-radius0pxdivn2-ss-43
20px 20px 20px3
20px 20px box-shadow3
20px box-shadow noneborder-width3
pbs kids12
detroit public10
detroit pbs9
noneline-height 15font-weight8
great lakes8
normalword-spacing normaltext-transform8
leftletter-spacing normalword-spacing8
nonetext-align leftletter-spacing8
normaltext-decoration nonetext-align8
normalfont-style normaltext-decoration8
15font-weight normalfont-style8
normaltext-transform nonefont-weight8
20px 20px6
public tv6
nonefont-weight 400divn2-ss-46
noneborder-width 0pxborder-style5
box-shadow noneborder-width5
0pxborder-style solidborder-color5
lakes now4
virtual camps4
kids virtual4
live tv4
learn more4
robotoarialcolor 1890d7font-size100text-shadow4
1890d7font-size100text-shadow noneline-height4
300 2504
solidborder-color ffffff4
ffffff border-color4
one detroit4
read now3
dptv passport3
0px 0px3
thank you3
20px box-shadow3
border-color rgba2552552551border-radius0pxdivn2-ss-43
mobile app3
schedule detroit3
kids schedule3
kids live3
your favorite3
detroit30
kids24
03816
pbs16
public14
tv14
now11
schedule10
lakes9
20px9
live9
nonetext-align8
15font-weight8
normalfont-style8
normaltext-decoration8
nonefont-weight8
leftletter-spacing8
normalword-spacing8
normaltext-transform8
view8
great8
noneline-height8
home7
400divn2-ss-46
your6
programs6
robotoarialcolor6
dptv6
n2-ss-button-container6
more6
programming6
support6
box-shadow5
noneborder-width5
solidborder-color5
border-color5
new5
education5
0pxborder-style5
05
0px5
resources5
you5
local4
september4
1890d7font-size100text-shadow4
free4
content4
leadership4
ffffff4
passport4
one4
n2-font-b186d6f1bd16dbdbfe32a36fc13ed5a9-paragraph4
learning4
divn2-ss-44
var4
virtual4
camps4
windowgoogletag4
googletagcmdpushfunction4
14
24
n2-font-f1873f98e45041c78bf73ffc77c7db41-paragraph4
divdivn2-ss-44
other4
mobile4
learn4
video4
shows3
favorite3
watch3
report3
placeholder3
news3
us3
sign-up3
read3
part3
ways3
policy3
features3
notices3
thank3
jazz3
rgba2552552551border-radius0pxdivn2-ss-43
credit3
channel3
app3
arts3
children3
nextend-arrow-animated-vertical3
n2-activedivn2-ss-43
n2-ss-slider-33
truevar3

Dptv.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Dptv.org is a scam?

Websites with Similar Names

Dptv.org
Detroit Public TV – WTVS – Detroit's PBS Station
Dptvision.com
Doctor of Physical Therapy Visionary Foundation, Inc.
Dptvmedia.org
Media – Detroit Public TV

Recently Updated Websites

Zo-intern.de 4 seconds ago.Powertec.fr 5 seconds ago.Jolietmarketreports.net 11 seconds ago.Viadolorosaonline.org 11 seconds ago.Mostmadison.org 13 seconds ago.Carbonlord.com 15 seconds ago.Hzhqdq.com 15 seconds ago.Biltmorecoffeeroasters.com 15 seconds ago.Billbrennan.org 15 seconds ago.Adulttoyroom.com 15 seconds ago.Mmjdronline.com 16 seconds ago.Rileywellslaw.com 16 seconds ago.Thehotspurway.com 16 seconds ago.Philiphydephotographycollector.com 16 seconds ago.Cubaexplora.com 17 seconds ago.Artcraftmusic.com 17 seconds ago.Baku-guide.com 19 seconds ago.Babycaresupplier.com 19 seconds ago.Ck-smigiel.pl 19 seconds ago.Tachyon-da.com 20 seconds ago.A-4-paper.com 20 seconds ago.Ugurkanerez.com 20 seconds ago.Privatedeal.info 21 seconds ago.Robinyapp.co.uk 21 seconds ago.Thejerseycompany.co.uk 21 seconds ago.Yetanotherproxy-1.appspot.com 22 seconds ago.Cemlasers.com 22 seconds ago.Trichurarchdiocese.org 22 seconds ago.Starpoint.com.br 23 seconds ago.Thestorybehindamnesty.com 23 seconds ago.