Domain summary

Last updated
2020-11-02
Domain label
dragonus
Domain extension
pl
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is dragonus.pl ranked relative to other sites:

Percentage of visits to dragonus.pl from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Dragonus.pl registered?
A: Dragonus.pl was registered 5 months, 2 weeks, 5 days, 8 hours, 27 minutes, 21 seconds ago on Monday, November 2, 2020.
Q: When was the WHOIS for Dragonus.pl last updated?
A: The WHOIS entry was last updated 5 months, 2 weeks, 5 days, 8 hours, 27 minutes, 21 seconds ago on Monday, November 2, 2020.
Q: What are Dragonus.pl's nameservers?
A: DNS for Dragonus.pl is provided by the following nameservers:
  • dns.home.pl
  • dns3.home.pl
  • dns2.home.pl
Q: Who is the registrar for the Dragonus.pl domain?
A: The domain has been registered at NASK.
Q: What is the traffic rank for Dragonus.pl?
A: Dragonus.pl has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Dragonus.pl each day?
A: Dragonus.pl receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Dragonus.pl resolve to?
A: Dragonus.pl resolves to the IPv4 address 89.161.210.79.
Q: In what country are Dragonus.pl servers located in?
A: Dragonus.pl has servers located in the Poland.
Q: What webserver software does Dragonus.pl use?
A: Dragonus.pl is powered by IdeaWebServer/0.83.514 webserver.
Q: Who hosts Dragonus.pl?
A: Dragonus.pl is hosted by home.pl S.A. in Poland.
Q: How much is Dragonus.pl worth?
A: Dragonus.pl has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Dragonus.pl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Dragonus.pl Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Dragonus.pl

H1 Headings

0 :

H2 Headings

1 :
  1. Ograniczenia w działaniu sklepu stacjonarnego

H3 Headings

29 :
  1. Regulamin
  2. Polityka prywatności
  3. Wypożyczalnia gier
  4. Rabaty
  5. Turnieje
  6. Formularz kontaktowy
  7. Kontakt
  8. Menu
  9. Wyróżnienia dla firmy
  10. Bestsellery
  11. Promocje
  12. Produkt dnia
  13. Nowości
  14. Producenci
  15. Artykuły
  16. Polecane produkty
  17. PRZEDSPRZEDAŻ! NOWOŚĆ!Premiera zapowiadana na 11 grudnia 2020 r. Wysyłka i odbiór PO PREMIERZE!
  18. UWAGA! Do każdego zamówionego egzemplarza gry Solar City dodajemy 1 zestaw promocyjny niedostępny w sprzedaży (budynek Crown - karta + 9 żetonów)! - do wyczerpania zapasów.
  19. PRZEDSPRZEDAŻ! NOWOŚĆ!Premiera zapowiadana na grudzień 2020 r. Wysyłka i odbiór PO PREMIERZE!
  20. PRZEDSPRZEDAŻ! NOWOŚĆ!Premiera zapowiadana na IV kwartał 2020 r. Wysyłka i odbiór PO PREMIERZE!
  21. PRZEDSPRZEDAŻ! NOWOŚĆ!Premiera zapowiadana na III kwartał 2020 r. Wysyłka i odbiór PO PREMIERZE!
  22. PRZEDSPRZEDAŻ! NOWOŚĆ!Premiera zapowiadana na 2021 r. Wysyłka i odbiór PO PREMIERZE!
  23. PRZEDSPRZEDAŻ! NOWOŚĆ!Premiera zapowiadana na IV kwartał 2020 r.Wysyłka i odbiór PO PREMIERZE!
  24. PRZEDSPRZEDAŻ! NOWOŚĆ!Premiera zapowiadana na II połowę 2020 r.Wysyłka i odbiór PO PREMIERZE!
  25. PRZEDSPRZEDAŻ! NOWOŚĆ!Premiera zapowiadana na IV kwartał 2020 r.Wysyłka i odbiór PO PREMIERZE!
  26. PRZEDSPRZEDAŻ! NOWOŚĆ!Premiera zapowiadana na IV kwartał 2020 r.Wysyłka i odbiór PO PREMIERZE!
  27. Koszyk
  28. Współpraca
  29. Płatności online

H4 Headings

0 :

H5 Headings

1 :
  1. 16-03-2020

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

110 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-6244961-2

Links - Internal

119:

Links - Outbound

3:

Links - Outbound (nofollow)

0:

Keyword Cloud for Dragonus.pl

po premierzekartserce miastapolskapo premierze promocjaosadnicywysyka 24lubmaorazkrostawiec24 godziny solarszt do koszykaterraformacja marsagdziedo koszyka0dlael puzzlepokemonpromocjestanowiislandskrzydach ptakiterraformacjamaa ilosolar city 2shieldmieczjestcenakoszykaeverdellkadegokoszyka przedsprzedasuburbia24 godziny everdellprzedsprzeda nowopremiera zapowiadanaodbirnowopremiera zapowiadana naivgrzesztnowopremiera zapowiadanacarcassonne2 dodatkina skrzydach ptakiwysyka popuzzle educacity 2 dodatkirednia ilozupeniepolska przedsprzeda cenaraquo8500zedycja polska cenacitypuzzlepathcookieswicej3dostpno maa1el puzzle educatejgodziny solar citymidzyoceaniichampion039s pathpatnocicena 6990zkartyszt dogragierzapowiadana naprzedsprzeda wysykawieowcenaiv kwartapremierzegodziny solardua iloodbir popremierze promocja everdellprzedsprzedazapowiadana naiv kwarta2020 rwysykatedostpno dua ilowpokemon swordwpywyetonwimperiumodbir po premierzezawierapokemon sword amp635 champion039s path18900zgrypromocjawyprzedagames6990zswordgodzinydodatkisi wpromocja everdellwysyka 24 godzinycena 18900zcity 2odshield 35 champion039svaredycja polska24 godzinyedycja polska przedsprzedazktrzyilo wysykanoweprzedsprzeda nowopremierapremierze promocjadostpno przedsprzedabdzieciemaado koszyka przedsprzedarabatysword amp shieldmaa ilo wysykadostpno maa ilodostpno przedsprzeda wysyka7500zpolska cenagraczedo grywydawnictwokwarta 2020 rwysyka5rwysykazupenie nowychskrzydachoprzedsprzeda cena 18900ztylkotaliido500 el puzzlerozgrywkiniekwartaptakitreflredniadostpno duagraczydostpno rednia ilosi500 el35 champion039sbigmarsa2nowopremieradostpnopremiumwysykakoszyka przedsprzeda nowopremieradua ilo wysykawysyka gratiskadyczysolar cityspiritilorwysyka i odbirdostpno redniaboxdodatkwbdeducagratisnowychletniboostersercerednia ilo wysykaamp shieldamp2990zedycjakwarta 2020naiv kwarta 2020nowopremiera zapowiadana naelsolarplikwzestawsword amppldodatekprzedsprzeda cenatakeplikw cookiesshield 35godziny everdellzapowiadanaduaimwysyka po premierzechampion039sponaiveuropypolska przedsprzedazapowiadana naivbudynkwprzedsprzeda wysyka ponaamp shield 35ktre4ilo wysyka 24miastana skrzydach

Longtail Keyword Density for Dragonus.pl

KeywordsOccurences
szt do koszyka30
ilo wysyka 2421
wysyka 24 godziny21
maa ilo wysyka11
dostpno maa ilo11
rwysyka i odbir9
wysyka po premierze9
przedsprzeda wysyka po9
dostpno przedsprzeda wysyka9
odbir po premierze9
do koszyka przedsprzeda9
przedsprzeda nowopremiera zapowiadana9
koszyka przedsprzeda nowopremiera9
po premierze promocja9
sword amp shield5
dostpno rednia ilo5
rednia ilo wysyka5
kwarta 2020 rwysyka5
pokemon sword amp5
dua ilo wysyka5
dostpno dua ilo5
el puzzle educa4
24 godziny everdell4
naiv kwarta 20203
zapowiadana naiv kwarta3
nowopremiera zapowiadana naiv3
edycja polska cena3
przedsprzeda cena 18900z3
na skrzydach ptaki3
nowopremiera zapowiadana na3
edycja polska przedsprzeda3
polska przedsprzeda cena3
amp shield 353
shield 35 champion039s3
35 champion039s path3
500 el puzzle3
city 2 dodatki3
solar city 23
godziny solar city3
24 godziny solar3
premierze promocja everdell3
do koszyka32
szt do30
24 godziny21
wysyka 2421
ilo wysyka21
po premierze18
maa ilo11
dostpno maa11
solar city11
premierze promocja9
przedsprzeda wysyka9
dostpno przedsprzeda9
odbir po9
nowopremiera zapowiadana9
przedsprzeda nowopremiera9
koszyka przedsprzeda9
wysyka po9
przedsprzeda cena9
edycja polska7
2020 rwysyka7
puzzle educa5
dostpno dua5
pokemon sword5
rednia ilo5
kwarta 20205
sword amp5
amp shield5
dostpno rednia5
dua ilo5
el puzzle4
na skrzydach4
si w4
zupenie nowych4
godziny everdell4
polska cena4
wysyka gratis4
terraformacja marsa3
naiv kwarta3
zapowiadana naiv3
cena 18900z3
zapowiadana na3
polska przedsprzeda3
plikw cookies3
cena 6990z3
serce miasta3
do gry3
2 dodatki3
city 23
godziny solar3
500 el3
champion039s path3
35 champion039s3
shield 353
skrzydach ptaki3
promocja everdell3
do60
w52
games36
wysyka34
z32
koszyka32
szt31
dostpno30
cena30
przedsprzeda28
na25
godziny22
022
ilo21
si18
premierze18
po18
everdell14
gry13
edycja13
city12
ktre11
maa11
solar11
zupenie10
nowopremiera9
zapowiadana9
promocja9
rwysyka9
odbir9
o9
polska8
amp8
puzzle8
pokemon8
wyprzeda8
graczy8
17
gra7
miasta7
el7
lub7
imperium6
educa6
wicej6
shield6
rednia5
kwarta5
nowych5
take5
booster5
zestaw5
od5
dua5
sword5
dla5
kart5
oraz5
box5
czy4
gdzie4
raquo4
dodatkw4
grze4
ptaki4
gier4
gratis4
bdziecie4
kady4
budynkw4
wydawnictwo4
24
krostawiec4
pl4
nowe4
talii4
tylko4
skrzydach4
jest4
karty4
midzy3
wpywy3
ma3
tej3
naiv3
terraformacja3
cookies3
rozgrywki3
gracze3
nie3
dodatek3
letni3
island3
stanowi3
ktrzy3
marsa3
18900z3
oceanii3
6990z3
osadnicy3
spirit3
33
champion039s3
path3
43
europy3
2990z3
8500z3
im3
7500z3
bd3
patnoci3
trefl3
plikw3
premium3
rabaty3
miecz3
53
big3
carcassonne3
63
kadego3
etonw3
wieowce3
te3
dodatki3
promocje3
zawiera3
serce3
suburbia3
var3

Who hosts Dragonus.pl?

Dragonus.pl Hosting Provider Information

Hosted IP Address:89.161.210.79
Hosted Hostname:cloudserver041227.home.pl
Service Provider:home.pl S.A.
Hosted Country:PolandPL
Location Latitude:52.2394
Location Longitude:21.0362
Webserver Software:IdeaWebServer/0.83.514

Is "home.pl S.A." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
home.pl S.A.
0.0779%

HTTP Header Analysis for Dragonus.pl

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 02 Nov 2020 16:44:23 GMT
Content-Type: text/html; charset="utf-8"
Transfer-Encoding: chunked
Connection: keep-alive
Server: IdeaWebServer/0.83.514
Strict-Transport-Security: max-age=60; includeSubdomains
X-Powered-By: Milk and cookies
Content-Encoding: gzip

Dragonus.pl Domain Nameserver Information

HostIP AddressCountry
dns.home.pl 217.160.80.244
dns3.home.pl 217.160.82.251
dns2.home.pl 217.160.81.248


Need to find out who hosts Dragonus.pl?


Domain Registration (WhoIs) information for Dragonus.pl

 request limit exceeded 

Websites with Similar Names

Drago-accessories.com
סלולר | דרגו אביזרי סלולר אבי לוסקי | מחוז הצפון
Drago-baotic.com
Drago Baotic Music
Drago-bilbija.com
- DRAGO BILBIJA
Drago-boats.com
Főoldal - Hajósboltok - Lőcsey és Társa
Drago-brat.com
ДРАГОБРАТ - горнолыжный комплекс
Drago-fly.ru
Access denied | drago-fly.ru used Cloudflare to restrict access
Drago-inden.net
STRATO - Domain reserved
Drago-riter.de
403 Forbidden

Recently Updated Websites

Mailzig.com (1 second ago.)Edetective.online (1 second ago.)Ewares.org (1 second ago.)Quality-telegram-to-witness-today.info (2 seconds ago.)Yapaibet145.net (2 seconds ago.)Winterco.us (3 seconds ago.)Epmexhibits.com (3 seconds ago.)Troyrowland.com (4 seconds ago.)Klik-berlin.de (5 seconds ago.)150northrestaurantandlounge.com (5 seconds ago.)Illinoiscountryliving.com (5 seconds ago.)Ysscar98.com (5 seconds ago.)Bestcustodylawyerssf.com (6 seconds ago.)Miro360.com.ar (6 seconds ago.)Principalfirstfinancial.com (6 seconds ago.)Abcoptic.com (6 seconds ago.)Farookkottakkal.org (6 seconds ago.)Openroadlexusrichmond.com (6 seconds ago.)1fitcrazy.net (7 seconds ago.)Austincommercialrealestate.net (7 seconds ago.)Mothmademoiselle.com (7 seconds ago.)Cyl.media (7 seconds ago.)Altro.cloud (7 seconds ago.)Brazomax.com (8 seconds ago.)Anightinforhospice.org (8 seconds ago.)Tricotdesigns.com (8 seconds ago.)Ligne500.com (9 seconds ago.)Reoblogger.com (9 seconds ago.)Amaryllis.co.uk (10 seconds ago.)Fibak.com (10 seconds ago.)

Recently Searched Keywords

colorfff important (1 second ago.)000000colorrgb87 (1 second ago.)manual do aluno – novo currículo (9 seconds ago.)local2global (10 seconds ago.)condemn (11 seconds ago.)www.indiacheaphosting.com (16 seconds ago.)affiche de stade de sport à partir de €39 (17 seconds ago.)400 hide all (19 seconds ago.)tractor forum (19 seconds ago.)come lavoriamo (20 seconds ago.)养生 (21 seconds ago.)bike share (21 seconds ago.)paradidáticos em inglês (22 seconds ago.)ntlh - nova tradução na linguagem de hoje (23 seconds ago.)posted march 5 (24 seconds ago.)nvi - nova versão internacional (29 seconds ago.)aggressive stroke for cum sluts cei (30 seconds ago.)holiday season (30 seconds ago.)tc th (33 seconds ago.)5 tips traveling hemat ala backpacker (35 seconds ago.)apartment finder (36 seconds ago.)usman vs. masvidal 2 (37 seconds ago.)  mua bán nhà đất lăk (39 seconds ago.)sem neque sed (49 seconds ago.)semper libero sit (50 seconds ago.)amet adipiscing sem (51 seconds ago.)adipiscing sem neque (53 seconds ago.)sem neque (54 seconds ago.)howtos (55 seconds ago.)campintouch crane lake (1 minute 5 seconds ago.)