Drugfree.org  |  Partnership for Drug-Free Kids - Where Families Find Answers
Low trust score  | 
We reduce substance abuse among adolescents by supporting families and engaging with teens.

Drugfree.org Website Information

Website Ranks & Scores for Drugfree.org

Statvoo Rank Statvoo Rank:E
Alexa Rank Alexa Rank:124,998
Majestic Rank Majestic Rank:10,594
Domain Authority Domain Authority:79%
DMOZ DMOZ Listing:No

Whois information for drugfree.org

Full Whois Lookup for Drugfree.org Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Drugfree.org. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Registry Domain ID: D1516334-LROR
Registrar WHOIS Server:
Registrar URL: http://www.networksolutions.com
Updated Date: 2017-04-06T19:57:59Z
Creation Date: 1997-03-04T05:00:00Z
Registry Expiry Date: 2026-03-05T05:00:00Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C3100281-LROR
Registrant Name: Domain Administrative
Registrant Organization: Partnership at Drugfree.org
Registrant Street: 352 PARK AVE S
Registrant City: New York
Registrant State/Province: NY
Registrant Postal Code: 10010-1709
Registrant Country: US
Registrant Phone: +1.2129221560
Registrant Phone Ext:
Registrant Fax: +1.9999999999
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C3100602-LROR
Admin Name: Shirley Stevens Domain Administrative
Admin Organization: Domain Administrative
Admin Street: Partnership for a Drug-Free America
Admin Street: 352 Park Avenue South
Admin City: New York
Admin State/Province: NY
Admin Postal Code: 10010
Admin Country: US
Admin Phone: +1.2129221560
Admin Phone Ext:
Admin Fax: +1.2129221570
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C3100602-LROR
Tech Name: Shirley Stevens Domain Administrative
Tech Organization: Domain Administrative
Tech Street: Partnership for a Drug-Free America
Tech Street: 352 Park Avenue South
Tech City: New York
Tech State/Province: NY
Tech Postal Code: 10010
Tech Country: US
Tech Phone: +1.2129221560
Tech Phone Ext:
Tech Fax: +1.2129221570
Tech Fax Ext:
Tech Email: Login to show email
Name Server: NS60.WORLDNIC.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-10-09T00:24:09Z

Who hosts Drugfree.org?

Drugfree.org is hosted by Rackspace Hosting in Virginia, Ashburn, United States, 20146.
Drugfree.org has an IP Address of and a hostname of and runs nginx/1.0.15 web server.

Drugfree.org Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:Rackspace Hosting
Hosted Country:United StatesUS
Location Latitude:39.0437
Location Longitude:-77.4875
Webserver Software:nginx/1.0.15
Google Map of 50,12

HTTP Header Analysis for Drugfree.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.0.15
Vary: Accept-Encoding
Cache-Control: no-store, no-cache, must-revalidate, max-age=0
Content-Type: text/html; charset=UTF-8
Content-Encoding: gzip
Date: Wed, 29 Jul 2015 15:41:32 GMT
X-Pingback: http://www.drugfree.org/xmlrpc.php
Link:; rel=shortlink
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Pragma: no-cache
Connection: keep-alive
X-Powered-By: PHP/5.4.43
Content-Length: 36765

Need to find out who hosts Drugfree.org?

Drugfree.org Free SEO Report

Website Inpage Analysis for Drugfree.org

H1 Headings:5
Partnership for Drug-Free Kids – Where Families Find Answers
Features & News
Tackling our Nation's Drug Epidemic
I want to help
Join Us
H2 Headings:1
Get confidential one-on-one support for your family.
H3 Headings:5
I want to…
How Can I Protect My Child from Fentanyl? 5 Things Parents Need to Know
Cincinnati Reds Bring Partnership Resources to Families in Ohio
Parent Coach Training Takes Place in Nashville, Tennessee
Winter Wish Gala
H4 Headings:3
Join Us
Support Us
Follow Us
H5 Headings:0
H6 Headings:0
Total IFRAMEs:2
Total Images:8
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Drugfree.org

action planmedicinegetfamily038learnsubstancejoinabuseyournowplansupportprojectactiongiveconnectparentchildneedwinterhelphelp yourfindgalaparent coachjoin usxpersonalized action plan18553784373coachwishepidemicaddictionpersonalizedhelp youtheircanwish galawinter wish galapersonalized actionteendrugpartnershipyour childwinter wishtalkcounselorhopestrugglingyouhelplinefamiliesfentanylnewsresourceshelp uscommunitymedicine abuseweotheronesubstance useuseourdonatelearn moreriskusparentsmoretreatmentkidssearch

Longtail Keyword Density for Drugfree.org

winter wish gala3
personalized action plan3
learn more7
join us4
help your4
substance use4
your child3
medicine abuse3
parent coach3
winter wish3
wish gala3
help you3
personalized action3
action plan3
help us3

What are the nameservers for drugfree.org?

Drugfree.org Domain Nameserver Information

HostIP AddressCountry
ns59.worldnic.com States United States
ns60.worldnic.com States United States

Drugfree.org DNS Record Analysis DNS Lookup

drugfree.orgNS7200Target: ns59.worldnic.com
drugfree.orgNS7200Target: ns60.worldnic.com
drugfree.orgSOA7200MNAME: NS59.WORLDNIC.COM
Serial: 115051210
Refresh: 10800
Retry: 3600
Expire: 604800
drugfree.orgMX3600Target: drugfree-org.mail.protection.outlook.com
drugfree.orgTXT3600TXT: v=spf1
include:spf.protection.outlook.com -all
drugfree.orgTXT3600TXT: MS=ms56986838

Alexa Traffic Rank for Drugfree.org

Alexa Search Engine Traffic for Drugfree.org
