Fabricación Mobiliario Acero inoxidable Colombia

Safety: Low trust score
Year Founded: 2012
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Líderes en el diseño, fabricación e intalación de muebles y enseres en Acero Inoxidable y Acero al Carbón en Colombia.



Domain summary

Last updated
2021-03-10
Domain label
durata
Domain extension
co
Domain registered:
2012-00-16
Domain updated:
2020-00-24
Domain expires:
2021-00-15
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Durata.co registered?
A: Durata.co was registered 9 years, 10 months, 2 days, 10 hours, 7 minutes, 8 seconds ago on Friday, December 16, 2011.
Q: When was the WHOIS for Durata.co last updated?
A: The WHOIS entry was last updated 1 year, 9 months, 3 weeks, 4 days, 10 hours, 7 minutes, 8 seconds ago on Tuesday, December 24, 2019.
Q: What are Durata.co's nameservers?
A: DNS for Durata.co is provided by the following nameservers:
  • ns11.wixdns.net
  • ns10.wixdns.net
Q: Who is the registrar for the Durata.co domain?
A: The domain has been registered at .CO Internet, S.A.S..
Q: What is the traffic rank for Durata.co?
A: Durata.co has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Durata.co each day?
A: Durata.co receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Durata.co resolve to?
A: Durata.co resolves to the IPv4 address 185.230.63.186.
Q: In what country are Durata.co servers located in?
A: Durata.co has servers located in the United States.
Q: What webserver software does Durata.co use?
A: Durata.co is powered by Pepyaka/1.19.0 webserver.
Q: Who hosts Durata.co?
A: Durata.co is hosted by Fara Negar Pardaz Khuzestan in Virginia, Ashburn, United States, 20147.
Q: How much is Durata.co worth?
A: Durata.co has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Durata.co Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Durata.co Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Durata.co

H1 Headings

3 :
  1. MAPA DE SITIO
  2. CONTACTO
  3. ​SÍGUENOS

H2 Headings

8 :
  1. LÍDERES EN EL DISEÑO, FABRICACIÓN E INSTALACIÓN DE MUEBLES Y ENSERES  EN ACERO INOXIDABLE Y ACERO AL CARBÓN
  2. ACERO INOXIDABLE
  3. HIERRO
  4. NOSOTROS
  5. PROYECTOS
  6. CLIENTES
  7. SÍGUENOS
  8. CONTACTO

H3 Headings

0 :

H4 Headings

6 :
  1. Calle 51 # 41-129, Itagüí Antioquia Colombia
  2. + 574 4444370
  3. + 57 317 6668023
  4. [email protected]
  5. © 2020 Todos los derechos reservados

H5 Headings

0 :

H6 Headings

6 :
  1. Aeropuerto Simón Bolivar Santa Marta
  2. Metro de Medellín
  3. Alcaldía de Medellín
  4. Planta De Tratamiento De Aguas Residuales Bello (PTAR)
  5. Parques Del Río
  6. Ciudad del Rio

Total IFRAMEs

3 :

Total Images

34 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

3:

Links - Outbound (nofollow)

0:

Keyword Cloud for Durata.co

colorcolortransparenttextshadow0 0 046 461colorffffffbordernoneb0b0b0right0borderleftwidth1pxstylekhwjxm83repeaterbuttonlabelhelveticaw01lighthelveticaw02lightsansserifselectmozfocusring colortransparenttextshadow0 0colombiatypetitlechildrenfabricacin mobiliario aceroultxtnew oljustifycontentcenteravenirltw0185heavy1475544sansserifnormal normal normalpor1transitionbackgroundcolor490px 05selectnotdatapreviewfocusinvalid borderwidth2px borderstylesolidbordercolorrgba24958 1borderwidth0 backgroundcolorrgba23011backgroundcolorrgba255inoxidable y247 247 1color3b3a3awordbreakbreakworddisplayinlineblocklineheight11215selectnotdatapreviewfocusinvalid05var15px14emcolombiapageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaide6zctihwenpcc1bgmetadatapageide6zctispresetfalseschemaversion10ishiddenfalsemediareftypeimageide6zctdesktopmediarefmetadatapageide6zctispresetfalseschemaversion20ishiddenfalsetitledurataaceroinoxidablemedellinjpguri388ab3533f3870e72c435aa073696c16adefd8mv2jpgdescriptionprivatef27b00d245af4059bb30d5fd2e1b1556width3872height2592altartistidnameopacity1colorcolor11aligntypebottomfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaide6zctmobilebgmetadatapageide6zctispresetfalseschemaversion10ishiddenfalsemediareftypeimageide6zctmobilemediarefmetadatapageide6zctispresetfalseschemaversion20ishiddenfalsetitledurataaceroinoxidablemedellinjpguri388ab3533f3870e72c435aa073696c16adefd8mv2jpgdescriptionprivatef27b00d245af4059bb30d5fd2e1b1556width3872height2592altartistidnameopacity1colorcolor11aligntypebottomfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypemetapropsnamedescriptioncontentlderes5px05s ease1transitionbackgroundcolor 04sacero1 stylekdakwhohmenucontainerstylekignboy7linkstylekdakwhohmenucontainerrightdirectionmueblesselectmsexpand980px 05mercadoneue helveticaneuew0155roma helveticaneuew0255romastylekdakwhohsubmenu stylekdakwhohitemselectfocusmsvaluenoticia textserif1backgroundcolorrgba255 255 255fontnormal normalif204 204 1colorffffffbackgroundcolorrgba204conimagebutton1defaultimagergba43 108 163alcontenthelvetica arial14displaynoneselectnotdatapreviewfocusinvalid borderwidth2pxavenirltw0135light1475496sansserifelhelveticaneuew0255roma helveticaneuew1055romaselectdataerrortruemargin018 1positionfixed importantleftautoycalc100 490px15px14em helveticaw01lighthelveticaw02lightsansserif color3b3a3awordbreakbreakworddisplayinlineblocklineheight11colorffffffbackgroundcolorrgba2040 000rgba237 205 310s255 1 stylekdakwhohmenucontainereasepositionabsolutetop0right0bottom0left0mobiliario acero inoxidablefontnormal normal normal0pxhelvetica0s backgroundcolorbackgroundcolorrgba230 230 230backgroundcolorrgba204 204 204normal 12px14emrgba43 108textalignlastleftpadding0colombiametakeywordsseopagetitleseofabricacin mobiliarioselect option204 204colombiatypetitlechildrenfabricacinstylekdakwhohmenucontainer0 004s ease 0sstylekasxgq831navcontainerulpositionstaticboxshadow0001transitionbackgroundcolor 04s easetransitioncolorunaolcolor888888select option textoverflowellipsiswhitespacenowrapoverflowhiddencolor44474dbackgroundcolorffffffstrc1dataresponsivediseo fabricacin eselectdatapreviewerror stylekasxgq831navcontainerarrow04s ease0positionrelativewhitespacenowrapdiseo fabricacintransitioncolor 04s230 1borderstylesolidbordercolorrgba199249 1backgroundcolorrgba255 255rgba0 0230 1borderstylesolidbordercolorrgba199 18normal 14px14emjustifycontentflexendborderwidth2pxbordercolorrgba204490pxhelveticaneuew1055roma helvetica arial2px rgba43 108rgba237stylekasxgq831navcontainercenterdirectionmuebles yneue helveticaneuew0155romastylekdakwhohmenucontainerarrowborderwidth2px borderstylesolidbordercolorrgba249txtnew230 230 1borderstylesolidbordercolorrgba199stylekhwjxm83navcontainerleftdirectionbackgroundcolorrgba204 204boxsizingborderboxbordertop10pxselectmsexpand displaynonestylekdakwhohlabelstylekhwjxm83repeaterbuttondatastatedropstylekdakwhohmenucontainerarrowstylekdakwhohmenucontainerrightdirectionselectdatapreviewhoverel mercadobackgroundcolorrgba230border0boxshadownone8stylekhwjxm83navcontainercenterdirectionborderstylesolidbordercolorrgba249solid rgba237 205255 255 1carbn en colombiametakeywordsseopagetitleseofabricacin6divrgba47 46stylekdakwhohmenucontainerarrow stylekdakwhohmenucontainersvgcontainerborderleft0borderwidth1px backgroundcolorrgba230 230normal 15px14emstylekdakwhohitemstylekdakwhohmenucontainerleftdirection1borderstylesolidbordercolorrgba199backgroundcolorinoxidable y aceroselectmozfocusring colortransparenttextshadow0selectmozfocusringsvg204 1colorffffffbackgroundcolorrgba204stylekasxgq831navcontainerleftdirectionstylekhwjxm83navcontainerarrowstylekhwjxm83navcontainercenterdirection204 1colorffffffbordernone42 75 112px14emintalacincolorffffff14px14em avenirltw0135light1475496sansserifintalacin de mueblesbackgroundcolor ffffff1bordercolortransparentcolor3b3a3atransitioncolor 04s easenormal230 1borderstylesolidbordercolorrgba17backgroundcolorrgba230 230helveticaneuew0155roma helveticaneuew0255roma0s backgroundcolor 04sselecthoverstrc1inlinecontentstylekasxgq831navcontainersvgcontainer1 stylekhwjxm83navcontainerwidth100borderwidth2px borderstylesolidbordercolorrgba249 249normal 15px14em helveticaw01lighthelveticaw02lightsansserifhelveticaneuew0255romanormal normal 12px14em16stylekhwjxm83navcontainerrightdirection204 204 1bordersolid18 18acero inoxidable249 249 1backgroundcolorrgba255helveticaw01lighthelveticaw02lightsansserif color3b3a3awordbreakbreakworddisplayinlineblocklineheight118 18 1topautobottom0fabricacincolortransparenttextshadow01borderradius0calc100 490px 05marginleft calc100904sopacity0diseostylekhwjxm83repeaterbuttongapperborderwidth1pxease 0sselectdatapreviewerror stylekhwjxm83navcontainerarrowbackgroundtransparentstylekdakwhohmenucontainersvgcontainerdisplaywebkitboxdisplaywebkitflexdisplayflexwebkitboxorientverticalwebkitboxdirectionnormalwebkitflexdirectioncolumnflexdirectioncolumnstylekdakwhohsubmenupositionabsolutetop0right0bottom0left0transitionbordercolormargin0lineheightnormalletterspacingnormal txtnew05s ease 0s230 230borderright042 75stylekebihy2zlinkcolor949494width12px18calc100backgroundcolorrgba204normal 14px14em avenirltw0135light1475496sansserifpositionfixed importantleftauto importantzindex50y enseres230 1borderstylesolidbordercolorrgba17 420color3b3a3atransitioncolor75 1borderwidth2pxbordercolorrgba204 204 204ecolor ffffffel diseo1borderstylesolidbordercolorrgba17 42stylekhwjxm83navcontainerarrowstylekhwjxm83navcontainerrightdirection1bordersolid rgba59solid rgba47rgba59 58 58normal normal 14px14emsolid rgba47 46selectpositionfixedcursordefault important0 0 013230 230 1borderstylesolidbordercolorrgba1758 58stylekignboy7labelwrapperfont normal normalmarginleft calc100 490px204 204 1fabricacin e intalacinstylekhwjvu5abg2pxstylekhwjxm83repeaterbuttongapper border0borderradius0nuestros1borderstylesolidbordercolorrgba199 18stylekhwjxm83navcontainerarrowstylekhwjxm83navcontainerleftdirection000ffffffacero al carbntextaligninitialdisplayflexalignitemscenter247 117stylekdakwhohmenucontainerarrowstylekdakwhohmenucontainercenterdirectionselectdatapreviewfocus255 1 stylekhwjxm83navcontainercolombiatypetitlechildrenfabricacin mobiliariocolortransparenttextshadow0 0borderwidth1px backgroundcolorrgba230borderwidth0stylekasxgq831repeaterbuttonlabel255 1 stylekasxgq831navcontainerrgba59 58selectfocusborderwidth0 backgroundcolorrgba230 230optionnormal normalselectfocusmsvalue backgroundtransparentcolor3b3a3acolombiapageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaide6zctihwenpcc1bgmetadatapageide6zctispresetfalseschemaversion10ishiddenfalsemediareftypeimageide6zctdesktopmediarefmetadatapageide6zctispresetfalseschemaversion20ishiddenfalsetitledurataaceroinoxidablemedellinjpguri388ab3533f3870e72c435aa073696c16adefd8mv2jpgdescriptionprivatef27b00d245af4059bb30d5fd2e1b1556width3872height2592altartistidnameopacity1colorcolor11aligntypebottomfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaide6zctmobilebgmetadatapageide6zctispresetfalseschemaversion10ishiddenfalsemediareftypeimageide6zctmobilemediarefmetadatapageide6zctispresetfalseschemaversion20ishiddenfalsetitledurataaceroinoxidablemedellinjpguri388ab3533f3870e72c435aa073696c16adefd8mv2jpgdescriptionprivatef27b00d245af4059bb30d5fd2e1b1556width3872height2592altartistidnameopacity1colorcolor11aligntypebottomfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypemetapropsnamedescriptioncontentlderes en el16px14empositionabsolutetop0left0color373737width100height100oldirrtlpositionabsolutetop0right0bottom0left0transitionbordercolor 04s easemobiliario acero1bordersolid rgba59 581borderstylesolidbordercolorrgba17 42 75imagebutton1hoverimageclientes1pxnoticiabackgroundcolor 04s easeal carbn204 1bordersolid rgba59stylekasxgq831repeaterbuttonwrapperimagebutton1datastatepressed204 1bordersolidimportantmarginleft calc100 980pxnormal normal 16px14em05s205 31y acero al15px14em helveticaw01lighthelveticaw02lightsansserifstylekebihy1sinput1backgroundcolorrgba255rgba237 205delborderwidth2pxel diseo fabricacinfont normalmarginleftselectdatapreviewerror stylekdakwhohmenucontainerarrowimportantzindex50positionstaticboxshadow000 0 0color3b3a3atransitioncolor 04scalc100 980px45pxcursorpointerpositionrelativemaxwidth100minwidth100minheight10pxheight100textoverflowellipsiswhitespacenowrapdisplayblockstylekigndmwhlabelwrapperstylekasxgq831navcontainerrightdirectioncalc100 980px 05positionabsolutetop0right0bottom0left0transitionbordercolor 04sopacity0 imagebutton1datastatepressed1colorffffffbackgroundcolorrgba204 204 204boxsizingborderboxbordertop10px solidstylekasxgq831navcontainerarrowstylekasxgq831navcontainerrightdirectioncarbnbackgroundcolorrgba255 255 255font255 255textalignlastlefttextalignlastcenterrgba475arialnormal normal 15px14emcolortransparentbackgroundcolor 04srgba43color112a4bstylekdakwhohmenucontainercenterdirection7stylekasxgq831navcontainerarrow stylekasxgq831navcontainersvgcontainer2stylekebihy2zlabelwrapper15px14em noticianeuebackgroundcolortransparentbordersolidimagebutton1activeimage1borderstylesolidbordercolorrgba199 18 18stylekdakwhohsubmenubeforecolombiametakeywordsseopagetitleseofabricacin46 1helveticaneuew1055roma46 46 1108 163helveticaneuew0155romaborderstylesolidbordercolorrgba249 249 249textserifstylekhwjxm83navcontainersvgcontainer14px14em249 2491 stylekasxgq831navcontainerrgba59rgba0textaligncenterol ul1colorffffffbackgroundcolorrgba204 204helveticaneuew1055roma helvetica255 1option textoverflowellipsiswhitespacenowrapoverflowhiddencolor44474dbackgroundcolorffffffstylekasxgq831navcontainerarrowstylekhwjxm83navcontainerarrowimportantleftauto importantzindex50rgba0 0 058 58 11borderstylesolidbordercolorrgba17247 247textoverflowellipsiswhitespacenowrapoverflowhiddencolor44474dbackgroundcolorfffffftextalignlastrightdirectionrtl10overflowhidden31bordersolidjustifycontentflexstarttransitioncolor 04s easeborderwidth2pxbordercolorrgba204 2041positionstaticboxshadow000 0helveticaneuew0155roma helveticaneuew0255roma helveticaneuew1055romasolidcarbn en colombiatypetitlechildrenfabricacin204 204 1colorffffffbordernonenormal 15px14em noticiaenseres50 50acero alstylekignboy7labelstylekhwjxm83navcontainerarrow stylekhwjxm83navcontainersvgcontainer0 0 000204 12px rgba43content colortransparentstylekebihy2zlabel41backgroundcolorrgba255 25515px14em noticia textserifacero inoxidable colombiapageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaide6zctihwenpcc1bgmetadatapageide6zctispresetfalseschemaversion10ishiddenfalsemediareftypeimageide6zctdesktopmediarefmetadatapageide6zctispresetfalseschemaversion20ishiddenfalsetitledurataaceroinoxidablemedellinjpguri388ab3533f3870e72c435aa073696c16adefd8mv2jpgdescriptionprivatef27b00d245af4059bb30d5fd2e1b1556width3872height2592altartistidnameopacity1colorcolor11aligntypebottomfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaide6zctmobilebgmetadatapageide6zctispresetfalseschemaversion10ishiddenfalsemediareftypeimageide6zctmobilemediarefmetadatapageide6zctispresetfalseschemaversion20ishiddenfalsetitledurataaceroinoxidablemedellinjpguri388ab3533f3870e72c435aa073696c16adefd8mv2jpgdescriptionprivatef27b00d245af4059bb30d5fd2e1b1556width3872height2592altartistidnameopacity1colorcolor11aligntypebottomfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypemetapropsnamedescriptioncontentlderesinoxidablestylekhwjxm83navcontainercolombiametakeywordsseopagetitleseofabricacin mobiliario acerocursordefaultlb1itemscontainerbackgroundcolorrgba255 255solid rgba237stylekasxgq831navcontainerarrowstylekasxgq831navcontainerleftdirectiony aceromargin0lineheightnormalletterspacingnormalenseres en aceroease 0s backgroundcolorborderradius5pxstylekigndmwhlabelopacity1rgba47 46 46left10pxright10pxfabricacin eimportantleftautonormal 16px14eminoxidable colombiapageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaide6zctihwenpcc1bgmetadatapageide6zctispresetfalseschemaversion10ishiddenfalsemediareftypeimageide6zctdesktopmediarefmetadatapageide6zctispresetfalseschemaversion20ishiddenfalsetitledurataaceroinoxidablemedellinjpguri388ab3533f3870e72c435aa073696c16adefd8mv2jpgdescriptionprivatef27b00d245af4059bb30d5fd2e1b1556width3872height2592altartistidnameopacity1colorcolor11aligntypebottomfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaide6zctmobilebgmetadatapageide6zctispresetfalseschemaversion10ishiddenfalsemediareftypeimageide6zctmobilemediarefmetadatapageide6zctispresetfalseschemaversion20ishiddenfalsetitledurataaceroinoxidablemedellinjpguri388ab3533f3870e72c435aa073696c16adefd8mv2jpgdescriptionprivatef27b00d245af4059bb30d5fd2e1b1556width3872height2592altartistidnameopacity1colorcolor11aligntypebottomfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypemetapropsnamedescriptioncontentlderesfontnormalimagebutton1datastatehoveredborderstylesolidbordercolorrgba249 249muebles y enseres249 1backgroundcolorrgba255stylekasxgq831navcontainerarrowstylekasxgq831navcontainercenterdirectionstylekigndmwhlinke intalacin980pxboxsizingborderboxbordertop10px solid rgba237stylekdakwhohmenucontainerarrowstylekdakwhohmenucontainerleftdirectionacero inoxidable yselectdatapreviewerrorstylekebihy2rtextareastylekhwkmyknbg204 1colorffffffbackgroundcolorrgba204 204mobiliariotextalignlefthelveticaneuew0255roma helveticaneuew1055roma helveticatxtnew ulultxtnew

Longtail Keyword Density for Durata.co

KeywordsOccurences
margin-left calc100 980px55
calc100 980px 0555
04s ease 0s22
fontnormal normal normal18
normal normal 15px14em12
255 255 112
1background-colorrgba255 255 25511
normal normal normal11
border-stylesolidborder-colorrgba249 249 24911
border-width2px border-stylesolidborder-colorrgba249 24911
background-colorrgba230 230 23011
font normal normal11
y acero al9
42 75 19
acero al carbn9
acero inoxidable y9
diseo fabricacin e9
el diseo fabricacin9
249 249 1background-colorrgba2559
249 1background-colorrgba255 2559
inoxidable y acero9
muebles y enseres9
enseres en acero8
calc100 490px 058
normal 15px14em helvetica-w01-lighthelvetica-w02-lightsans-serif8
intalacin de muebles8
margin-left calc100 490px8
mobiliario acero inoxidable8
fabricacin e intalacin8
1border-stylesolidborder-colorrgba17 42 756
border-width0 background-colorrgba230 2306
230 230 1border-stylesolidborder-colorrgba176
230 1border-stylesolidborder-colorrgba17 426
positionstaticbox-shadow000 0 06
border-width2pxborder-colorrgba204 204 2046
2px rgba43 1085
rgba43 108 1635
helveticaneuew01-55roma helveticaneuew02-55roma helveticaneuew10-55roma5
normal normal 14px14em5
helveticaneuew10-55roma helvetica arial5
05s ease 0s5
background-colorrgba255 255 2555
neue helveticaneuew01-55roma helveticaneuew02-55roma5
rgba0 0 05
rgba59 58 585
helveticaneuew02-55roma helveticaneuew10-55roma helvetica5
solid rgba47 464
rgba47 46 464
46 46 14
18 18 14
1border-stylesolidborder-colorrgba199 18 184
230 1border-stylesolidborder-colorrgba199 184
230 230 1border-stylesolidborder-colorrgba1994
border-width1px background-colorrgba230 2304
1bordersolid rgba59 584
58 58 14
247 247 14
0 0 04
15px14em noticia textserif4
normal 15px14em noticia4
1transitionbackground-color 04s ease4
255 1 style-kasxgq831navcontainer4
normal 14px14em avenir-lt-w0135-light1475496sans-serif4
colombiapageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaide6zctihwenpcc1bgmetadatapageide6zctispresetfalseschemaversion10ishiddenfalsemediareftypeimageide6zctdesktopmediarefmetadatapageide6zctispresetfalseschemaversion20ishiddenfalsetitledurata-acero-inoxidable-medellinjpguri388ab3533f3870e72c435aa073696c16adefd8mv2jpgdescriptionprivatef27b00d245af4059bb30d5fd2e1b1556width3872height2592altartistidnameopacity1colorcolor11aligntypebottomfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaide6zctmobilebgmetadatapageide6zctispresetfalseschemaversion10ishiddenfalsemediareftypeimageide6zctmobilemediarefmetadatapageide6zctispresetfalseschemaversion20ishiddenfalsetitledurata-acero-inoxidable-medellinjpguri388ab3533f3870e72c435aa073696c16adefd8mv2jpgdescriptionprivatef27b00d245af4059bb30d5fd2e1b1556width3872height2592altartistidnameopacity1colorcolor11aligntypebottomfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypemetapropsnamedescriptioncontentlderes en el3
rgba237 205 313
solid rgba237 2053
box-sizingborder-boxborder-top10px solid rgba2373
carbn en colombiatypetitlechildrenfabricacin3
colombiametakeywordsseopagetitleseofabricacin mobiliario acero3
acero inoxidable colombiapageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaide6zctihwenpcc1bgmetadatapageide6zctispresetfalseschemaversion10ishiddenfalsemediareftypeimageide6zctdesktopmediarefmetadatapageide6zctispresetfalseschemaversion20ishiddenfalsetitledurata-acero-inoxidable-medellinjpguri388ab3533f3870e72c435aa073696c16adefd8mv2jpgdescriptionprivatef27b00d245af4059bb30d5fd2e1b1556width3872height2592altartistidnameopacity1colorcolor11aligntypebottomfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaide6zctmobilebgmetadatapageide6zctispresetfalseschemaversion10ishiddenfalsemediareftypeimageide6zctmobilemediarefmetadatapageide6zctispresetfalseschemaversion20ishiddenfalsetitledurata-acero-inoxidable-medellinjpguri388ab3533f3870e72c435aa073696c16adefd8mv2jpgdescriptionprivatef27b00d245af4059bb30d5fd2e1b1556width3872height2592altartistidnameopacity1colorcolor11aligntypebottomfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypemetapropsnamedescriptioncontentlderes3
normal normal 16px14em3
positionfixed importantleftauto importantz-index503
carbn en colombiametakeywordsseopagetitleseofabricacin3
normal normal 12px14em3
select-moz-focusring colortransparenttext-shadow0 03
background-color 04s ease3
color3b3a3atransitioncolor 04s ease3
255 1 style-kdakwhohmenucontainer3
0 0 0003
select option text-overflowellipsiswhite-spacenowrapoverflowhiddencolor44474dbackground-colorffffff3
204 204 1colorffffffbackground-colorrgba2043
204 1colorffffffbackground-colorrgba204 2043
1colorffffffbackground-colorrgba204 204 2043
204 204 13
204 204 1colorffffffbordernone3
15px14em helvetica-w01-lighthelvetica-w02-lightsans-serif color3b3a3aword-breakbreak-worddisplayinline-blockline-height13
selectnotdata-previewfocusinvalid border-width2px border-stylesolidborder-colorrgba2493
255 1 style-khwjxm83navcontainer3
positionabsolutetop0right0bottom0left0transitionborder-color 04s ease3
ease 0s background-color3
0s background-color 04s3
colortransparenttext-shadow0 0 03
transitioncolor 04s ease3
background-colorrgba204 204 2043
204 204 1bordersolid3
204 1bordersolid rgba593
colombiatypetitlechildrenfabricacin mobiliario acero3
margin-left calc10063
980px 0555
calc100 980px55
normal normal44
ease 0s28
0 024
255 25524
04s ease23
fontnormal normal18
acero inoxidable17
42 7514
204 20412
230 23012
255 112
normal 15px14em12
background-colorrgba230 23011
1background-colorrgba255 25511
border-stylesolidborder-colorrgba249 24911
border-width2px border-stylesolidborder-colorrgba24911
font normal11
249 24911
el diseo10
muebles y10
108 1639
fabricacin e9
diseo fabricacin9
249 1background-colorrgba2559
y acero9
acero al9
inoxidable y9
75 19
y enseres9
al carbn9
calc100 490px8
e intalacin8
490px 058
mobiliario acero8
15px14em helvetica-w01-lighthelvetica-w02-lightsans-serif8
205 317
margin0line-heightnormalletter-spacingnormal txtnew7
230 1border-stylesolidborder-colorrgba176
border-width0 background-colorrgba2306
border-width2pxborder-colorrgba204 2046
46 466
positionstaticbox-shadow000 06
1border-stylesolidborder-colorrgba17 426
1 style-khwjxm83navcontainer5
rgba43 1085
1 style-kdakwhohmenucontainer5
noticia textserif5
normal 14px14em5
2px rgba435
58 585
background-colorrgba255 2555
rgba59 585
helveticaneuew02-55roma helveticaneuew10-55roma5
helveticaneuew10-55roma helvetica5
helvetica arial5
neue helveticaneuew01-55roma5
05s ease5
helveticaneuew01-55roma helveticaneuew02-55roma5
1 style-kasxgq831navcontainer5
247 2475
rgba0 05
border-width1px background-colorrgba2304
247 14
230 1border-stylesolidborder-colorrgba1994
1border-stylesolidborder-colorrgba199 184
15px14em noticia4
58 14
18 184
18 14
46 14
1transitionbackground-color 04s4
1bordersolid rgba594
14px14em avenir-lt-w0135-light1475496sans-serif4
txtnew ul4
background-color ffffff4
color ffffff4
solid rgba474
50 504
rgba47 464
inoxidable colombiapageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaide6zctihwenpcc1bgmetadatapageide6zctispresetfalseschemaversion10ishiddenfalsemediareftypeimageide6zctdesktopmediarefmetadatapageide6zctispresetfalseschemaversion20ishiddenfalsetitledurata-acero-inoxidable-medellinjpguri388ab3533f3870e72c435aa073696c16adefd8mv2jpgdescriptionprivatef27b00d245af4059bb30d5fd2e1b1556width3872height2592altartistidnameopacity1colorcolor11aligntypebottomfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaide6zctmobilebgmetadatapageide6zctispresetfalseschemaversion10ishiddenfalsemediareftypeimageide6zctmobilemediarefmetadatapageide6zctispresetfalseschemaversion20ishiddenfalsetitledurata-acero-inoxidable-medellinjpguri388ab3533f3870e72c435aa073696c16adefd8mv2jpgdescriptionprivatef27b00d245af4059bb30d5fd2e1b1556width3872height2592altartistidnameopacity1colorcolor11aligntypebottomfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypemetapropsnamedescriptioncontentlderes3
style-khwjxm83repeaterbuttongapper border03
background-colorrgba204 2043
color3b3a3atransitioncolor 04s3
el mercado3
selectdata-previewerror style-khwjxm83navcontainerarrow3
style-khwjxm83navcontainerarrow style-khwjxm83navcontainersvgcontainer3
transitioncolor 04s3
colombiametakeywordsseopagetitleseofabricacin mobiliario3
204 1bordersolid3
204 1colorffffffbordernone3
background-color 04s3
colortransparenttext-shadow0 03
normal 16px14em3
normal 12px14em3
positionfixed importantleftauto3
importantleftauto importantz-index503
ultxtnew ol3
ol ul3
box-sizingborder-boxborder-top10px solid3
solid rgba2373
rgba237 2053
opacity0 imagebutton1data-statepressed3
selectnotdata-previewfocusinvalid border-width2px3
select option3
option text-overflowellipsiswhite-spacenowrapoverflowhiddencolor44474dbackground-colorffffff3
select-moz-focusring colortransparenttext-shadow03
0 0003
0s background-color3
select-ms-expand displaynone3
selectfocus-ms-value backgroundtransparent3
204 1colorffffffbackground-colorrgba2043
1colorffffffbackground-colorrgba204 2043
204 13
style-kasxgq831navcontainerarrow style-kasxgq831navcontainersvgcontainer3
selectdata-previewerror style-kasxgq831navcontainerarrow3
helvetica-w01-lighthelvetica-w02-lightsans-serif color3b3a3aword-breakbreak-worddisplayinline-blockline-height13
content colortransparent3
cursordefault important3
style-kdakwhohsubmenu style-kdakwhohitem3
style-kdakwhohmenucontainerarrow style-kdakwhohmenucontainersvgcontainer3
selectdata-previewerror style-kdakwhohmenucontainerarrow3
positionabsolutetop0right0bottom0left0transitionborder-color 04s3
colombiatypetitlechildrenfabricacin mobiliario3
normal77
calc10063
margin-left63
0563
980px55
051
148
247
background-color39
color37
ease29
0s28
acero27
y26
324
424
04s23
522
positionabsolutetop0right0bottom0left020
fontnormal18
txtnew18
inoxidable17
important16
style-kdakwhohmenucontainer15
el15
614
714
solid13
2px13
style-khwjxm83navcontainer13
style-kasxgq831navcontainer13
812
15px14em12
border-width2px12
style-kdakwhohmenucontainerarrow11
border-radius011
0px11
background-colorrgba23011
ul11
style-kasxgq831navcontainerarrow11
border-stylesolidborder-colorrgba24911
1background-colorrgba25511
style-khwjxm83navcontainerarrow11
font11
muebles10
al10
e10
910
style-kdakwhohsubmenu10
diseo10
1010
1110
enseres9
selecthover9
selectdata-previewhover9
selectfocus9
selectdata-previewfocus9
selectdata-errortrue9
carbn9
selectdata-previewerror9
helvetica-w01-lighthelvetica-w02-lightsans-serif9
displaynone9
129
139
fabricacin9
style-kebihy1sinput9
ffffff8
490px8
148
intalacin8
mobiliario8
style-kdakwhohitem7
border-width07
var7
avenir-lt-w0185-heavy1475544sans-serif7
color3b3a3a7
ol7
157
167
margin0line-heightnormalletter-spacingnormal7
style-kdakwhohmenucontainerarrowstyle-kdakwhohmenucontainercenter-direction6
content6
border-width2pxborder-colorrgba2046
positionstaticbox-shadow0006
con6
style-kasxgq831navcontainerarrowstyle-kasxgq831navcontainercenter-direction6
style-kdakwhohmenucontainerarrowstyle-kdakwhohmenucontainerright-direction6
style-kasxgq831navcontainerarrowstyle-kasxgq831navcontainerright-direction6
style-kdakwhohmenucontainerarrowstyle-kdakwhohmenucontainerleft-direction6
style-khwjxm83repeaterbuttongapper6
border06
select6
avenir-lt-w0135-light1475496sans-serif6
overflowhidden6
style-khwjxm83navcontainerarrowstyle-khwjxm83navcontainerright-direction6
1border-stylesolidborder-colorrgba176
style-kebihy2rtextarea6
style-khwjxm83navcontainerarrowstyle-khwjxm83navcontainerleft-direction6
style-kasxgq831navcontainerarrowstyle-kasxgq831navcontainerleft-direction6
style-khwjxm83navcontainerarrowstyle-khwjxm83navcontainercenter-direction6
border-right05
if5
margin05
neue5
rgba435
imagebutton1hoverimage5
helveticaneuew01-55roma5
noticia5
textserif5
ultxtnew5
rgba595
imagebutton1defaultimage5
rgba05
imagebutton1activeimage5
del5
helvetica5
helveticaneuew02-55roma5
arial5
14px14em5
helveticaneuew10-55roma5
05s5
background-colorrgba2555
text-alignleft4
display-webkit-boxdisplay-webkit-flexdisplayflex-webkit-box-orientvertical-webkit-box-directionnormal-webkit-flex-directioncolumnflex-directioncolumn4
style-khwjxm83repeaterbuttonlabel4
mercado4
border-width1px4
1border-stylesolidborder-colorrgba1994
1px4
border-radius5px4
style-kigndmwhlabelwrapper4
style-kigndmwhlink4
colorffffff4
style-kdakwhohlabel4
1transitionbackground-color4
style-kigndmwhlabel4
color112a4b4
una4
text-aligncenter4
174
style-kebihy2zlabel4
b0b0b04
184
right0border-left-width1px4
style-kebihy2zlink4
1border-radius04
border-left04
opacity04
1bordersolid4
opacity14
rgba474
style-kignboy7label4
style-kignboy7link4
style-kignboy7labelwrapper4
style-kebihy2zlabelwrapper4
lb1itemscontainer4
positionabsolutetop0left0color373737width100height1004
style-khwjxm83navcontainerright-direction3
style-khwjxm83navcontainersvgcontainer3
style-khwjxm83navcontainerleft-direction3
background-colorrgba2043
color9494943
colombiapageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaide6zctihwenpcc1bgmetadatapageide6zctispresetfalseschemaversion10ishiddenfalsemediareftypeimageide6zctdesktopmediarefmetadatapageide6zctispresetfalseschemaversion20ishiddenfalsetitledurata-acero-inoxidable-medellinjpguri388ab3533f3870e72c435aa073696c16adefd8mv2jpgdescriptionprivatef27b00d245af4059bb30d5fd2e1b1556width3872height2592altartistidnameopacity1colorcolor11aligntypebottomfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaide6zctmobilebgmetadatapageide6zctispresetfalseschemaversion10ishiddenfalsemediareftypeimageide6zctmobilemediarefmetadatapageide6zctispresetfalseschemaversion20ishiddenfalsetitledurata-acero-inoxidable-medellinjpguri388ab3533f3870e72c435aa073696c16adefd8mv2jpgdescriptionprivatef27b00d245af4059bb30d5fd2e1b1556width3872height2592altartistidnameopacity1colorcolor11aligntypebottomfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueadvancedseodatatagstypemetapropsnamedescriptioncontentlderes3
style-khwjvu5abg3
positionfixed3
importantz-index503
topautobottom03
12px14em3
style-khwkmyknbg3
5px3
left10pxright10px3
por3
style-khwjxm83navcontainercenter-direction3
importantleftauto3
style-khwjxm83repeaterbuttondata-statedrop3
color3b3a3atransitioncolor3
nuestros3
clientes3
16px14em3
colombiametakeywordsseopagetitleseofabricacin3
1border-colortransparent3
style-kdakwhohmenucontainercenter-direction3
0positionrelativewhite-spacenowrap3
backgroundtransparent3
text-align-lastrightdirectionrtl3
style-kasxgq831navcontainerright-direction3
imagebutton1data-statehovered3
text-align-lastleft3
style-kasxgq831navcontainerleft-direction3
svg3
width12px3
style-kasxgq831navcontainersvgcontainer3
1colorffffffbordernone3
1colorffffffbackground-colorrgba2043
selectfocus-ms-value3
text-align-lastlefttext-align-lastcenter3
select-ms-expand3
0003
colortransparenttext-shadow03
select-moz-focusring3
color8888883
text-overflowellipsiswhite-spacenowrapoverflowhiddencolor44474dbackground-colorffffff3
option3
45pxcursorpointerpositionrelativemax-width100min-width100min-height10pxheight100text-overflowellipsiswhite-spacenowrapdisplayblock3
imagebutton1data-statepressed3
selectnotdata-previewfocusinvalid3
style-kasxgq831navcontainercenter-direction3
color3b3a3aword-breakbreak-worddisplayinline-blockline-height13
transitioncolor3
box-shadownone3
positionabsolutetop0right0bottom0left0transitionborder-color3
justify-contentflex-end3
justify-contentflex-start3
justify-contentcenter3
text-aligninitialdisplayflexalign-itemscenter3
width1003
strc1inlinecontent3
strc1data-responsive3
oldirrtl3
background-colortransparentbordersolid3
style-kdakwhohmenucontainerright-direction3
colortransparent3
style-kdakwhohmenucontainerleft-direction3
style-kdakwhohmenucontainersvgcontainer3
style-kdakwhohsubmenubefore3
box-sizingborder-boxborder-top10px3
rgba2373
style-kasxgq831repeaterbuttonlabel3
style-kasxgq831repeaterbuttonwrapper3
padding03
cursordefault3
div3
colombiatypetitlechildrenfabricacin3

Who hosts Durata.co?

Durata.co Hosting Provider Information

Hosted IP Address:185.230.63.186
Hosted Hostname:185.230.63.186
Service Provider:Fara Negar Pardaz Khuzestan
Hosted Country:United StatesUS
Location Latitude:39.018
Location Longitude:-77.539
Webserver Software:Pepyaka/1.19.0

Is "Fara Negar Pardaz Khuzestan" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%

HTTP Header Analysis for Durata.co

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 10 Mar 2021 19:55:15 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
x-wix-request-id: 1615406115.234170505823120313
link:; rel=preconnect; crossorigin,; rel=preconnect; crossorigin,; rel=preconnect;,; rel=preload; as=script;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preconnect; crossorigin;,; rel=preload; as=script ; crossorigin=anonymous
content-language: en
strict-transport-security: max-age=120
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=euw2
X-Seen-By: sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkViJbJpTSOylDzhXDpRcNc6B,qquldgcFrj2n046g4RNSVAWNqgzSMQ UB9IQX4udZ Q=,2d58ifebGbosy5xc FRalnJzA5R0fjwkG36emT0zRArHFkUbitFjm6/F78AB4jaW3fKEXQvQlSAkB/lstal9R73i9xLAFDBM1sgnz44DHz8=,2UNV7KOq4oGjA5 PKsX47LZ7Kls 1whC/C/a0aUIqJE=,LXlT8qjS5x6WBejJA3 gBZg/9V1SUvK0bWcMRSW44/FNG KuK VIZfbNzHJu0vJu,9phxMuSXVGy04obH0oEnZR0DYqc/dI2tUZ5liIod77W3rj3fUc9ov7g1wM2hfL1/,LXlT8qjS5x6WBejJA3 gBZg/9V1SUvK0bWcMRSW44/FNG KuK VIZfbNzHJu0vJu,LoUK8/saGAmOxZWtpubo2sh1VlYVRX4dNb8YFm8R2hJJyVWt8IexKjOAYFnpGq/uzLapJKw3k2uX8hzQyVuXpg==,w4q8mm9FnmU4emOs6psVXeIF2OLrHLyo60KKWbkCpKuTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,m7d0zj9X6FBqkyAIyh66vMuDPLKHZJHa25erYrAw TlNG KuK VIZfbNzHJu0vJu,Tw2AanFDQ Wwo8Xxk6ZL7vOBx hvh2Cbd7MMNUXzbHHuTSOmsKkeSGGVsD173CRugEa3bpnuPHrBiwAXjZQTCSCSASh374IAA/7VLSp2kFc=,m7d0zj9X6FBqkyAIyh66vMuDPLKHZJHa25erYrAw TlNG KuK VIZfbNzHJu0vJu,u3CNwl6zAd2E01MQck4H7Ncz9 zLw2dSc4pyIpd52QuTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,CU5GbgCT5nWPaA3tUS4mLIfXUA4StoSJP9ZYxad1CnZdYWPj98h6DMGKduN6W WMd9t5M9oy4bWAQulLUjplRw==
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Vary: Accept-Encoding
cache-control: private,max-age=0,must-revalidate
Content-Encoding: gzip
Server: Pepyaka/1.19.0

Durata.co Domain Nameserver Information

HostIP AddressCountry
ns11.wixdns.net 216.239.38.100
ns10.wixdns.net 216.239.36.100


Need to find out who hosts Durata.co?


Domain Registration (WhoIs) information for Durata.co

 Domain Name: durata.co
Registry Domain ID: D37317462-CO
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: whois.godaddy.com
Updated Date: 2020-11-24T23:14:40Z
Creation Date: 2012-10-16T12:43:04Z
Registry Expiry Date: 2021-10-15T23:59:59Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: Durata
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: Antioquia
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: CO
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: ns10.wixdns.net
Name Server: ns11.wixdns.net
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-03-10T19:55:16Z

Websites with Similar Names

Durat.com.tr
Durat iplik
Durata.co
Fabricación Mobiliario Acero inoxidable Colombia
Duratabusa.com
暮ディア | 暮ディアは、暮らしに関する様々な情報を発信するメディアブログです。
Duratac.com
Buy Domains - duratac.com is for sale!
Duratain.com
Duratain – You're not protected unless you're Duratain protected
Duratalbayt.com
شركة درة البيت - للخدمات المنزلية تنظيف منازل ومكافحة حشرات ونقل عفش وتركيب ورق حائط وكافة الأعمال الفنية بالمنزل بدولة الإمارات

Recently Updated Websites

Yayubet6167.com (1 second ago.)Loumyrelle.com (3 seconds ago.)Youngcarepartner.com (5 seconds ago.)Betchanolly.com (5 seconds ago.)Djdeja.com (5 seconds ago.)Reinsol.es (8 seconds ago.)Animachocolate.com (9 seconds ago.)Bealcoholsmart.com (10 seconds ago.)Axometal.com (11 seconds ago.)Benyoungphotography.com (13 seconds ago.)Digitalreadymusic.com (14 seconds ago.)02023z.com (14 seconds ago.)Empire-org.ru (15 seconds ago.)Ridealgo.com (18 seconds ago.)Bazzigo.cloud (18 seconds ago.)Bio-rohrmelasse.net (18 seconds ago.)Ellescottage.com (20 seconds ago.)Somosmiva.com (20 seconds ago.)Hardwarepneumatics.com (20 seconds ago.)Yaqi3616.vip (21 seconds ago.)Koleo.ca (23 seconds ago.)Sophiacirclejourneys.us (24 seconds ago.)Ybvip3922.vip (25 seconds ago.)Kreschatik-plaza.com (25 seconds ago.)Piscinesclassic.com (25 seconds ago.)Jgpies.com (26 seconds ago.)Throttle.tech (26 seconds ago.)Xisuban.com (27 seconds ago.)Hawstein.com (28 seconds ago.)Nachrichtenportal.com (28 seconds ago.)

Recently Searched Keywords

panasonic customer care pune (1 second ago.)streetstyle (1 second ago.)“click & collect” (5 seconds ago.)strategic sourcing (10 seconds ago.)able to put (11 seconds ago.)928服 (12 seconds ago.)w jaki sposb (16 seconds ago.)e government (17 seconds ago.)logoscurrentpage (17 seconds ago.)4e4e4e featuretype (18 seconds ago.)��ǰ (18 seconds ago.)reiserecht (19 seconds ago.)soccer news (20 seconds ago.)cc cng dn (20 seconds ago.)email marketing agency (24 seconds ago.)kids sunglasses (30 seconds ago.)sep 21 2020 (31 seconds ago.)sumo sushi (38 seconds ago.)русская озвучка (39 seconds ago.)sex workers south africa online (39 seconds ago.)kitsapsun obits (40 seconds ago.)profielfoto (43 seconds ago.)1990 hindi songs (46 seconds ago.)sex workers union south africa (48 seconds ago.)nm-model-band-1071498-models-5checked nm-model-band-containernm-j-model-band-container-is-opennm-j-model-band-container-sticky nm-model-band-container-models-item5 (51 seconds ago.)zman (53 seconds ago.)kontekcie (54 seconds ago.)portrait and landscape are (56 seconds ago.)france italia (57 seconds ago.)data loss prevention (58 seconds ago.)