Sallandse Aandacht | Deventer Ziekenhuis

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: 518,014
Estimated Worth: $2,640
Category: This site has not been categorized yet

We doen er alles aan om je te helpen. Dat doen we met Sallandse aandacht. We kijken verder dan je ziekte. Jouw leven, jouw Deventer Ziekenhuis.



Domain summary

Last updated
2021-04-01
Domain label
dz
Domain extension
nl
Global Traffic Rank
518,014
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$2,640
Estimated daily income
$11
Estimated monthly income
$335

Rank summary

How is dz.nl ranked relative to other sites:

Percentage of visits to dz.nl from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Dz.nl registered?
A: Dz.nl was registered 1 week, 4 days, 6 hours, 13 minutes, 27 seconds ago on Thursday, April 1, 2021.
Q: When was the WHOIS for Dz.nl last updated?
A: The WHOIS entry was last updated 1 week, 4 days, 6 hours, 13 minutes, 27 seconds ago on Thursday, April 1, 2021.
Q: What are Dz.nl's nameservers?
A: DNS for Dz.nl is provided by the following nameservers:
  • ns0.transip.net
  • ns1.transip.nl
  • ns2.transip.eu
Q: Who is the registrar for the Dz.nl domain?
A: The domain has been registered at Stichting Internet Domeinregistratie NL.
Q: What is the traffic rank for Dz.nl?
A: Dz.nl ranks 518,014 globally on Alexa. Dz.nl has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Dz.nl each day?
A: Dz.nl receives approximately 1,705 visitors and 3,410 page impressions per day.
Q: What IP address does Dz.nl resolve to?
A: Dz.nl resolves to the IPv4 address 31.7.7.99.
Q: In what country are Dz.nl servers located in?
A: Dz.nl has servers located in the Netherlands.
Q: What webserver software does Dz.nl use?
A: Dz.nl is powered by Nginx webserver.
Q: Who hosts Dz.nl?
A: Dz.nl is hosted by Previder B.V. in Netherlands.
Q: How much is Dz.nl worth?
A: Dz.nl has an estimated worth of $2,640. An average daily income of approximately $11, which is roughly $335 per month.

Dz.nl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Dz.nl Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Dz.nl

H1 Headings

0 :

H2 Headings

9 :
  1. Lees hier alle maatregelen
  2. Coronavac­ci­na­tie
  3. Kunstwerk 'Samen Sterk'
  4. Col­le­ga’s schie­ten ver­pleeg­huis te hulp
  5. Floortje vecht voor de tweede keer tegen kanker
  6. Aandacht voor jou
  7. MijnDZ
  8. Sallandse samenwerking
  9. Uw ervaring telt

H3 Headings

0 :

H4 Headings

2 :
  1. Wij maken gebruik van cookies
  2. Specialistische centra

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

4 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

94:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Dz.nl

helpeninformatienampnodigzorgeenlees hierexpertise centrumerexpertisemakenonshethoezodezelevenbezoekcookieshet kinderallergiemedischekanafspraakgraagkinderallergievangegevenskinderallergie behandelcentrumdoensnellerevalidatiecentrumziekenhuisallewebsitehieraanteltdeventer ziekenhuiskrijgtmijndzomjouwlees verderwerkenkan ikdatjeverderwond expertisejouw levenbijuwuw ervaringzijnafspraak makendievoortegebruikparkerenovercentrumaandachtweborstcentrumwondnaaruw ervaring teltwijumetbehandelcentrumbehandelingbij hetmaarervaring teltmogelijkhet kinderallergie behandelcentrumbezoektijdenwond expertise centrumonze websiteikervaringleesopdeventeronze

Who hosts Dz.nl?

Dz.nl Hosting Provider Information

Hosted IP Address:31.7.7.99
Hosted Hostname:da8.cloud.shockmedia.nl
Service Provider:Previder B.V.
Hosted Country:NetherlandsNL
Location Latitude:52.3824
Location Longitude:4.8995
Webserver Software:nginx

Is "Previder B.V." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
Previder B.V.
0.0034%

HTTP Header Analysis for Dz.nl

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: keep-alive
Server: nginx
Date: Thu, 01 Apr 2021 05:50:54 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Strict-Transport-Security: max-age=31536000; includeSubDomains
Content-Security-Policy: script-src 'self' 'unsafe-eval' localhost:8080 cdn1.readspeaker.com use.typekit.net p.typekit.net www.googletagmanager.com www.google-analytics.com 'unsafe-inline'; connect-src 'self' app-eu.readspeaker.com rstts-eu.readspeaker.com media-eu.readspeaker.com ws://localhost:8080/ http://localhost:8080/ https://www.google-analytics.com/; font-src 'self' data: use.typekit.net; frame-src 'self' *.youtube.com *.youtube-nocookie.com youtu.be app-eu.readspeaker.com
X-Frame-Options: SAMEORIGIN
X-Content-Type-Options: nosniff
X-Xss-Protection: 1; mode=block
Referrer-Policy: strict-origin-when-cross-origin
Feature-Policy: accelerometer 'none';autoplay 'none';camera 'none';encrypted-media 'none';fullscreen 'self';geolocation 'self';gyroscope 'none';magnetometer 'none';microphone 'none';midi 'none';payment 'self';picture-in-picture 'none';sync-xhr 'none';usb 'none';
Content-Encoding: gzip
Via: 1.1 vegur

Dz.nl Domain Nameserver Information

HostIP AddressCountry
ns0.transip.net 195.135.195.195
ns1.transip.nl 195.8.195.195
ns2.transip.eu 37.97.199.195


Need to find out who hosts Dz.nl?


Domain Registration (WhoIs) information for Dz.nl

 Domain name: dz.nl
Status: active

Registrar:
TransIP Group
Vondellaan 47
2332AA LEIDEN
Netherlands

Abuse Login to show email
Date: 1998-08-14

Updated Date: 2021-01-05

DNSSEC: yes

Domain nameservers:
ns0.transip.net
ns1.transip.nl
ns2.transip.eu

Record maintained by: NL Domain Registry

Copyright notice
No part of this publication may be reproduced, published, stored in a
retrieval system, or transmitted, in any form or by any means,
electronic, mechanical, recording, or otherwise, without prior
permission of the Foundation for Internet Domain Registration in the
Netherlands (SIDN).
These restrictions apply equally to registrars, except in that
reproductions and publications are permitted insofar as they are
reasonable, necessary and solely in the context of the registration
activities referred to in the General Terms and Conditions for .nl
Registrars.
Any use of this material for advertising, targeting commercial offers or
similar activities is explicitly forbidden and liable to result in legal
action. Anyone who is aware or suspects that such activities are taking
place is asked to inform the Foundation for Internet Domain Registration
in the Netherlands.
(c) The Foundation for Internet Domain Registration in the Netherlands
(SIDN) Dutch Copyright Act, protection of authors' rights (Section 10,
subsection 1, clause 1).

Websites with Similar Names

Dz-19.com
Argemet
Dz-19.net
Argemet
Dz-6b.blogspot.ru
Учимся дома
Dz-algerie.info
AlgerieInfo Presse Algerienne Journaux DZ : الصحف الجرائد الجزائرية
Dz-aluminium.fr
Accueil - DZ Aluminium
Dz-ambitions.org
Site en construction
Dz-android.com
menu テイクアウト&デリバリー 飲食店 評判 導入 – Just another WordPress site
Dz-androweb.com
dz-androweb.com
Dz-annonce-algerie.com
Dz Annonce Algérie

Recently Updated Websites

Carbonphonebook.com (3 seconds ago.)Expondo.it (4 seconds ago.)Matome-web.com (5 seconds ago.)Ycwmyl.com (5 seconds ago.)Headinwest.com (5 seconds ago.)Thegardennola.com (6 seconds ago.)Zensupport.co.uk (6 seconds ago.)Stealthex.money (7 seconds ago.)Xierhe.com (9 seconds ago.)Hildesevens.com (9 seconds ago.)Pdflinks.net (9 seconds ago.)Oldwiseguy.com (10 seconds ago.)Lhssupplies.ltd (10 seconds ago.)Imaginex.com (11 seconds ago.)Sitiitalia.it (12 seconds ago.)Eagledreamhealth.com (13 seconds ago.)Crystallinesecurities.info (13 seconds ago.)Genetic-programming.org (13 seconds ago.)Yangshangzhen.com (15 seconds ago.)Gouzai.win (15 seconds ago.)Junyiming.com (15 seconds ago.)66889n.com (16 seconds ago.)Zenchannel.com (17 seconds ago.)Endoscopy.report (17 seconds ago.)Rewardraisers.com (17 seconds ago.)Dineapart.com (17 seconds ago.)Noahhvolunteer.org (17 seconds ago.)Metalheart-webzine.com (19 seconds ago.)Buntyllc.com (20 seconds ago.)Picpac.net (20 seconds ago.)

Recently Searched Keywords

qadin cinsiyyet orqaninda yanma (1 second ago.)your desired (2 seconds ago.)furnituremattress (4 seconds ago.)binuo (4 seconds ago.)15:10 al feiha - al jabalain maçı canlı izle 24 kasım 2020 (5 seconds ago.)beautiful (6 seconds ago.)www.kyoook.com (6 seconds ago.)● musa eroäŸlu (7 seconds ago.)đau bụng dưới rốn là dấu hiệu của bệnh lý gì, có nguy hiểm không (8 seconds ago.)script spinning cube (10 seconds ago.)mentorcert (11 seconds ago.)setintervalnextslide wait (12 seconds ago.)st henry school kentucky (12 seconds ago.)omega sa (14 seconds ago.)important margin0 (16 seconds ago.)dogovoriti se na engleskom (17 seconds ago.)hc1bg (17 seconds ago.)birthday send me (18 seconds ago.)10 days three-dimensional (18 seconds ago.)masseys footwear coupons (19 seconds ago.)gursoy hazelnut (20 seconds ago.)památník (20 seconds ago.)vi di (20 seconds ago.)normal normal (21 seconds ago.)sliderimpulsesliderresizeheight width depth (21 seconds ago.)ddldatastate (23 seconds ago.)style-k63q6u1anavcontainerleft-direction (23 seconds ago.)tourespaña (23 seconds ago.)moving pics (23 seconds ago.)onyx avocats (25 seconds ago.)