E-katalog.ru  |  e-Katalog - каталог товаров, сравнение цен в интернет-магазинах России
Low trust score  | 
Каталог товаров E-KATALOG >>> все цены интернет-магазинов России ✔ Сравнение ✔ Отзывы ✔ Рейтинги, обзоры, видео.

E-katalog.ru Website Information

E-katalog.ru has a Low Trust Score, a Statvoo Rank of E, an Alexa Rank of 8,563, a Majestic Rank of 109,841, a Domain Authority of 43% and is not listed in DMOZ.

E-katalog.ru is hosted by LLC MASTERHOST in Moscow City, Moscow, Russian Federation, 109316.
E-katalog.ru has an IP Address of 83.222.5.198 and a hostname of 83.222.5.198.

The domain e-katalog.ru was registered 1 decade 6 years 5 months ago by , it was last modified 201 decades 8 years 9 months ago and currently is set to expire 3 years 5 months 3 weeks ago.


Whois information for e-katalog.ru

Full Whois Lookup for E-katalog.ru Whois Lookup

% By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: E-KATALOG.RU
nserver: ns3-l2.nic.ru.
nserver: ns4-cloud.nic.ru.
nserver: ns4-l2.nic.ru.
nserver: ns8-cloud.nic.ru.
nserver: ns8-l2.nic.ru.
state: REGISTERED, DELEGATED, VERIFIED
org: Price Compare Technologies Limited
registrar: RU-CENTER-RU
admin-contact: https://www.nic.ru/whois
created: 2003-01-23T21:00:00Z
paid-till: 2018-01-23T21:00:00Z
free-date: 2018-02-24
source: TCI

Last updated on 2017-10-19T09:21:32Z

Who hosts E-katalog.ru?

E-katalog.ru Web Server Information

Hosted IP Address:83.222.5.198
Hosted Hostname:83.222.5.198
Service Provider:LLC MASTERHOST
Hosted Country:RussiaRU
Location Latitude:55.7522
Location Longitude:37.6156
Webserver Software:Not Applicable

HTTP Header Analysis for E-katalog.ru

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 11 Jun 2015 13:10:22 GMT
Server: Apache
AMF-Ver: 4.03
X-Powered-By: PHP/5.2.17
Expires: Mon, 26 Jul 1997 05:00:00 GMT
Cache-Control: public
Pragma: no-cache
Last-Modified: Thu, 11 Jun 2015 13:10:22 GMT
Vary: User-Agent,Accept-Encoding
Content-Encoding: gzip
Content-Length: 17440
Content-Type: text/html; charset=windows-1251
Content-Language: win-1251


Need to find out who hosts E-katalog.ru?

E-katalog.ru Free SEO Report

Website Inpage Analysis for E-katalog.ru

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for E-katalog.ru

unic idgoodsmscanonrecessed controle idshop unic2function varcontrolhandlerheaderactionheightefunction e idshopactionwindowontrackwherebuytrueidshopwindowontrackwherebuy functionunicidshop unic idgoodcgalaxyfunctione idshop1tcontainer3function eifdidwindowontrackwherebuy function euniqidadwparamtypewidthrecessedtcontainer uniqidvarnewidgoodidshop uniceventwindowcriteoq0choicetestid

Longtail Keyword Density for E-katalog.ru

KeywordsOccurences
windowontrackwherebuy function e4
function e idshop4
e idshop unic4
idshop unic idgood4
recessed control13
function e5
function var5
windowontrackwherebuy function5
e idshop4
idshop unic4
unic idgood4
tcontainer uniqid3
var20
function19
control13
recessed13
011
uniqid10
true10
c9
idgood8
e7
event7
width7
16
unic5
windowontrackwherebuy5
d5
handler5
windowcriteoq4
idshop4
adwparam4
choice4
s4
24
action4
type4
if4
new4
tcontainer3
-3
33
ms3
height3
canon3
headeraction3
id3
testid3
galaxy3

What are the nameservers for e-katalog.ru?

E-katalog.ru Domain Nameserver Information

HostIP AddressCountry
ns3-l2.nic.ru 193.232.146.1Russia Russia
ns4-l2.nic.ru 91.217.20.1Russia Russia
ns8-l2.nic.ru 91.217.21.1Russia Russia

E-katalog.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if E-katalog.ru is a scam?