E-lotto.be  |  Welkom op e-lotto - Willkommen auf e-lotto - Jouez online sur e-lotto en français
Low trust score  | 
Lotto, Euro Millions, Joker+, Keno, Pick 3, Super Lotto, … Je kunt alle trekkingsspelen van de Belgische Nationale Loterij online spelen. Snel, makkelijk en betrouwbaar., Lotto, Euro Millions, Joker +, Keno, Pick 3, Super Lotto … Spielen Sie alle Ziehungsspiele der Nationallotterie online. Schnell, leicht und sicher., Lotto, Euro Millions, J...

E-lotto.be Website Information

E-lotto.be has a Low Trust Score, a Statvoo Rank of C, an Alexa Rank of 23,231, a Majestic Rank of 0, a Domain Authority of 31% and is not listed in DMOZ.

E-lotto.be is hosted by LOTERIE NATIONALE - NATIONALE LOTERIJ in Brussels Hoofdstedelijk Gewest, Brussels, Belgium, 1090.
E-lotto.be has an IP Address of 188.64.232.65 and a hostname of www.e-scoore.be.

The domain e-lotto.be was registered 201 decades 8 years 9 months ago by DNS Belgium, it was last modified 201 decades 8 years 9 months ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for e-lotto.be

Full Whois Lookup for E-lotto.be Whois Lookup

% .be Whois Server 6.1
%
% The WHOIS service offered by DNS Belgium and the access to the records in the DNS Belgium
% WHOIS database are provided for information purposes only. It allows
% persons to check whether a specific domain name is still available or not
% and to obtain information related to the registration records of
% existing domain names.
%
% DNS Belgium cannot, under any circumstances, be held liable where the stored
% information would prove to be incomplete or inaccurate in any sense.
%
% By submitting a query you agree not to use the information made available
% to:
% - allow, enable or otherwise support the transmission of unsolicited,
% commercial advertising or other solicitations whether via email or otherwise;
% - target advertising in any possible way;
% - to cause nuisance in any possible way to the domain name holders by sending
% messages to them (whether by automated, electronic processes capable of
% enabling high volumes or other possible means).
%
% Without prejudice to the above, it is explicitly forbidden to extract, copy
% and/or use or re-utilise in any form and by any means (electronically or
% not) the whole or a quantitatively or qualitatively substantial part
% of the contents of the WHOIS database without prior and explicit permission
% by DNS Belgium, nor in any attempt thereof, to apply automated, electronic
% processes to DNS Belgium (or its systems).
%
% You agree that any reproduction and/or transmission of data for commercial
% purposes will always be considered as the extraction of a substantial
% part of the content of the WHOIS database.
%
% By submitting the query you agree to abide by this policy and accept that
% DNS Belgium can take measures to limit the use of its whois services in order to
% protect the privacy of its registrants or the integrity of the database.
%

Domain: e-lotto.be
Status: NOT AVAILABLE
Registered: Wed Jul 15 2009

Registrant:
Not shown, please visit www.dnsbelgium.be for webbased whois.

Registrar Technical Contacts:
Name: DNS Master
Organisation: DigitasLBi Belgium sa/nv
Language: en
Phone: +32.27060540
Fax:
Email: Login to show email
DigitasLBi
Website: http://www.digitaslbi.com/be

Nameservers:
ns1.e-lotto.be (188.64.232.81)
ns2.e-lotto.be (188.64.232.82)
ns3.e-lotto.be (188.64.232.93)

Keys:

Flags:

Please visit www.dnsbelgium.be for more info.

Who hosts E-lotto.be?

E-lotto.be Web Server Information

Hosted IP Address:188.64.232.65
Hosted Hostname:www.e-scoore.be
Service Provider:LOTERIE NATIONALE - NATIONALE LOTERIJ
Hosted Country:BelgiumBE
Location Latitude:50.8504
Location Longitude:4.34878
Webserver Software:Not Applicable

HTTP Header Analysis for E-lotto.be

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 18 Jun 2015 21:11:26 GMT
Server: Microsoft-IIS/6.0
X-Frame-Options: SAMEORIGIN
X-UA-Compatible: IE=10
X-Powered-By: ASP.NET
X-AspNet-Version: 2.0.50727
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Length: 3949


Need to find out who hosts E-lotto.be?

E-lotto.be Free SEO Report

Website Inpage Analysis for E-lotto.be

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for E-lotto.be

cleanqptranslatepwsregistrationrequired translatecommonappcommonnewslettercontactupdatefirstnameerrortranslatemmcoreloginsubmittranslate ctrlnextdrawjackpotlnbcurrencyfalseboardpicksystemname rowpicksystemnamelast index1pickvaluevalueboardstaketranslatecommonapppwssubscriptionsdetailsstop translatecommonapppwssubscriptionsdetailsremovectrltileexternalid translatectrlnextdrawdetailsjackpotpwsregistrationrequired translatetranslate drawgamescommondetails translateacreslnbcurrencyfalsecommonapppwssubscriptionsdetailsstatus translateonlinei18nmonth translate betplacementdatetimedatedd betplacementdatetimedateddmmyyyy hhmmsscommonapploadmorecommonapppwssubscriptionsdetailsactivatedrawgamescommondetailstranslate pwsregistrationregistrationnumbertranslate pwsregistrationnotsamepasswordlnbcurrencysymbol drawgamesjackpotlegal ctrlnextdrawdetailslegallevelcommonapppwssubscriptionsdetailsactivate translatetranslatedrawgamedrawgameresulthistorydrawdatetranslatedrawgamedrawgameresulthistorydrawnumberstranslatedrawgamedrawgameresulthistorywinningtranslateresultshistorydrawdatedrawgamedrawgameresulthistorynodrawnumber translateresultshistorydrawnnumbers comalesslnbdgcurrencydrawgamestatisticsdate translatedrawgamestatisticsamountmmcoreplayhistorydetaildgyourcombination translateindex1pickvaluevalueboardstakenbspbannertextnbspbannershortdescription bannertitlectrlnextdrawdetailselotsomdetailsnumberofjackpotwinners x ctrlnextdrawdetailselotsomdetailstotalorestimatedjackpotmmcoreplayhistorydetailsbtotaldiscount translate mmcoreplayhistorydetailsbstakeafterdiscountbetdetailsbethistorydate todatectrlpicksystemstaketodate dateddmmyyyy hhmmsstranslatedrawgameslastdrawresultwinnersineuropelnbnumber0 lnbcurrencysymbol drawgamesjackpotlegaltranslatepwsregistrationrequired translatepwsregistrationnotvalidemail translatemmcoreloginenteryourpasswordlnbnumber0translate ctrlnextdrawdetailstsgetfullyeartodate i18nmonthmmcorecommonsavetranslate pwsregistrationrequired translatetranslate pwsregistrationphonenumber translaterowpicksystemnamelast mmcoreplayhistorydetaildgyourcombinationctrlpicksystemmaxextrapickvaluesgamenamepwsregistrationrequired translate pwsregistrationnotstrongpasswordpwsregistrationnotstrongpassword translatetranslatecommonapppwssubscriptionsdetailsstop translatecommonapppwssubscriptionsdetailsremove translatemmcoreplayhistorydetaildgyourgridtranslatecommonapppwssubscriptionsdetailsstopbull accountserviceaccountscreditpromobalancemmcoreplayhistorydetailsbdescriptiontranslate pwsregistrationnotstrongpassword translatedateddmmyyyyresultdrawgapdrawgamestatisticsdate translatedrawgamestatisticsamount translateresultdrawdateplaylimitsservicemaxdepositamountctrlnextdrawdetailselotsomdetailstotalorestimatedjackpot lnbnumber0 lnbcurrencysymbolmmcoreplayhistorydetaildgyourcombinationtranslate ctrlnextdrawdetailstsgetfullyear drawgamesjackpotaroundtranslate pwsregistrationphonenumbertranslate pwsregistrationnext translatemmcorecommonsave translatetranslate drawgamesdrawpricestitle translatetranslateresultsymbol comalessresulttotalcountresulttotalpercentagedrawgamesdrawstitle translatelnbpercentagestarsresultlastdrawdatedrawgamesdrawpricesinfo translatelnbdgcurrencyresultjackpot lnbdgcurrencyresulttotalwageramountlnbdgcurrencyeuromillionstarsresultssetmainnamedrawgamestatisticsball translatedrawgamestatisticscount translatedrawgamestatisticspercentagesign lowercasetranslateindex 1pickvaluevaluepickvaluevaluepickvaluevaluepickvaluevaluepickvaluevaluegridpicksystemnamebetplacementdatetime todatepwsregistrationnotsamepassword translate1pickvaluevaluepickvaluevaluepickvaluevaluepickvaluevaluepickvaluevaluegridpicksystemname rowpicksystemnamelasttranslate mmcoreplaylimitscancelchangestranslatemmcoreloginregisterheretranslatecommonappcommonnewslettercontactupdatefirstnameerrortranslatedrawgameslastdrawresultwinnersinbelgiumctrlnextdrawdetailslegalleveltranslatecommonapppwssubscriptionsdetailsmodify translatecommonapppwssubscriptionsdetailsstop translatecommonapppwssubscriptionsdetailsremovebannershortdescription bannertitletranslatepwsregistrationnotvalidemailmmcoreplaylimitsremaining translatehhmmssdrawgamesconfirmedittranslatedrawgameslastdrawresultgainpwsregistrationstep1 translatenodeitemnametranslate pwsregistrationnotsamepassword translatetranslatedrawgamestatisticscount translatedrawgamestatisticspercentagelnbcurrencysymbol drawgamesjackpotlegalmmcorecommoncancel translatedrawgamesboardyourgrids translatetranslate pwsregistrationstep1 translatelnbpercentageresultlastdrawdate dateddmmyyyyresultdrawgapdrawgamestatisticsdate translatedrawgamestatisticsamountctrlnextdrawts drawdatemediumtranslate commonapploadmoremmcorepersonaldetailslastname translate pwsregistrationrequiredctrlnextdrawjackpot lnbdgcurrency0index1pickvaluevalueboardstake lnbcurrencyfalseboardpicksystemnamedrawgamesdrawstitlebetplacementdatetime todate dateyyyylnbcurrencyfalsecommonapppwssubscriptionsdetailsstatuspwsregistrationphonepattern translate pwsregistrationphonenumberlnbnumber0 lnbcurrencysymboldrawgamedrawgameresulthistorynowinnermmcoreplayhistorydetailsbtotaldiscount translateindex1pickvaluevalueboardstake lnbcurrencyfalseboardpicksystemname rowpicksystemnamelastlowercasetranslate drawgamesconfirmedit translatetranslateerror mmcorepersonaldetailssuccessmmcorepersonaldetailslastnametranslate mmcorecommoncanceleventdrawdate todate dateddmmyyyytranslatedrawgamestatisticscounttranslate pwsregistrationprofessionemployee translatectrlnextdrawdetailselotsomdetailsnumberofjackpotwinners xloginformerrorreason translateerror mmcorecommonenteremailaddresstranslate egames ctrlannouncementgameidpwsregistrationnext translatetranslatedrawgamedrawgameresulthistorydrawdatetranslatedrawgamedrawgameresulthistorydrawnumberstranslatedrawgamedrawgameresulthistorywinningtranslateresultshistorydrawdatedrawgamedrawgameresulthistorynodrawnumber translateresultshistorydrawnnumbersctrlnextdrawdetailstsgetdatetranslatecommonappcommoncontactusunexpectederror translateerrornbspbannertextnbspbannershortdescription bannertitle nbspbannertextnbspbannershortdescriptionctrlnextdrawdetailstsgetfullyeartodate dateddctrlpicksystemmaxextrapickvalues ctrlpicksystemstake lnbcurrencyfalsemmcorecommoncanceltranslatestarsresultsymbolstarsresultcountstarsresulttotalpercentageegameslnbcurrencyfalse commonheadertradingbalance translatetranslatepwsregistrationrequired translatetranslatedrawgamesbreabcrumbsdated mmm yyyycommonapppwssubscriptionsdetailstotalstakepwsregistrationusernametranslate pwsregistrationopenaccount translatecommonappcommoncontactusunexpectederrortodate dateyyyytranslatedrawgameslastdrawresultwinningstars translatedrawgameslastdrawresultwinners translatedrawgameslastdrawresultwinnersinbelgiummmcorepersonaldetailspostcodeerrorinvalid translatecomaless twopointlesslnbdgcurrencyeuromillionstarsresultssetmainnamedrawgamestatisticsballtranslatedrawgamestatisticsamount translateresultdrawdate dateddmmyyyyresultbiggestprizetranslate drawgamescommondetailstranslate vmuserfirstnameindex1pickvaluevalueboardstakepwsregistrationnotsamepasswordbannershortdescriptiontranslatedrawgamedrawgameresulthistorydrawdatetranslatedrawgamedrawgameresulthistorydrawnumberstranslatedrawgamedrawgameresulthistorywinningtranslateresultshistorydrawdatedrawgamedrawgameresulthistorynodrawnumberdateyyyypwsregistrationstep2 translatedrawgamesboardtitletranslatemmcoreplayhistorydetaildgyourgridtranslate egameslnbcurrencyfalseboardpicksystemnametranslatedrawgameslastdrawresultwinnersinbelgium translatedrawgameslastdrawresultwinnersineurope translatedrawgameslastdrawresultgainlnbpercentageresultlastdrawdatedateddmmyyyydateddmmyyyydrawgamestatisticsball translatedrawgamestatisticscountcommonappcommoncontactusunexpectederror translateerrorctrlannouncementgameidcommonappinfotext translatetranslate betplacementdatetimetranslatedrawgameslastdrawresultwinners translatedrawgameslastdrawresultwinnersinbelgiumctrlnextdrawdetailstsgetmonth translateodds1pickvaluevaluepickvaluevaluepickvaluevaluepickvaluevaluepickvaluevaluegridpicksystemnametranslate mmcoreplaylimitscancelchanges translatemmcorecommonemailaddressdrawgamesjackpotlegaltranslate pwsregistrationpasswordconfirmationtwopointless whitespaceextraresultshistoryjackpotbannertext bannershortdescriptionlnbdgcurrency0translateresultsymbolbannertitle bannertext bannershortdescriptionlnbnumber0 lnbcurrencysymboldrawgamesboardtitle translatebannertitle nbspbannertextnbspbannershortdescriptionselectionpricetranslateerror mmcorecommonenteremailaddressyyyycommonapppwssubscriptionsdetailstotalstake translatetranslatemmcoreplayhistorytableheaderstatustranslatedrawgamestatisticspercentage translatedrawgamestatisticsdatelastdraw translateresultsymbolisphonedrawgamesaddontitletranslate mmcorepersonaldetailspostcodeerrorinvalidtodate i18ndayofweek translatemmcoreregistrationformerrorselectionprice odds 2translatecommonapppwssubscriptionsdetailsmodifylnbpercentageresultlastdrawdate dateddmmyyyyresultdrawgapdrawgamestatisticsball translatedrawgamestatisticscountdrawgamesjackpotwinon translatelnbdgcurrencydrawgamestatisticsdatevmuserfirstnamemmcoreplaylimitscancelchanges translatectrlnextdrawdetailstsgetmonthdatedd betplacementdatetime todatectrlnextdrawdetailstsgetmonth translate ctrlnextdrawdetailstsgetfullyearegames ctrlannouncementgameid nametranslate mmcoreplayhistorychannel betidswbusinesschannelx ctrlnextdrawdetailselotsomdetailstotalorestimatedjackpot lnbnumber0drawgamesgamenamedrawdatemedium drawgamesjackpotwinoni18ndayofweekdateddmmyyyyresultdrawgapdrawgamestatisticsball translatedrawgamestatisticscountctrlnextdrawts drawdatemedium drawgamesjackpotwinontranslate mmcorepersonaldetailspostcodeerrorinvalid translatecommonapppwssubscriptionsdetailsdepositmoneyandactivatetranslate pwsregistrationstep1translate pwsregistrationregistertoplayonlinepwsregistrationrequiredtranslate drawgamesdrawstitletranslate drawgamesboardquickpickpwsregistrationopenaccount translatetranslate mmcoreloginnoaccountmmcoreloginnoaccounttranslatemmcorepersonaldetailsfirstnametranslate mmcorecommoncancel translatepwsregistrationopenaccount translate xctrlnextdrawdetailstsgetday translate ctrlnextdrawdetailstsgetdatetranslatecommonappcommonnewslettercontactupdatefirstnameerror translatepwsregistrationrequired translate mmcorepersonaldetailspostcodeerrorinvalidlnbcurrencyfalse commonheaderpromobalancedateyyyy hhmmssmmcoreplayhistorydetailsbchannel translatetranslatelnbpercentageresultlastdrawdate dateddmmyyyyresultdrawgapdrawgamestatisticsdatetodate dateddmmyyyyeventdrawdatemmcoreplaylimitscancelchangesbetdetailsbettypectrlnextdrawdetailstsgetdate commonmonthtranslate pwsregistrationnotstrongpasswordtranslateerror commonappcommoncontactusunexpectederror translateerrorbannertitletranslateresultshistorydrawnnumberstranslate eventdrawdate todatetranslatecommonappcommonnewslettercontactupdatefirstnameerror translate mmcorepersonaldetailslastnamemmcoreplayhistorydetailsbstakeafterdiscounttranslateerror mmcoreregistrationformerrortranslate pwsregistrationselectoneof acrescommonmonthodds 2ctrlnextdrawdetailslegallevel ctrltileexternalidctrlpicksystemmaxextrapickvalues ctrlpicksystemstakemenuitemtext menuitemtexttranslate mmcorecommonfilterdrawgamesboardquickpick translatetranslateindex1pickvaluevalueboardstake lnbcurrencyfalseboardpicksystemnamedrawgamesjackpotlegal ctrlnextdrawdetailslegalleveldrawgamesjokerpluszodiacsign signtranslatecommonappcommonnewslettersubscriptionsubscribeerror translateerrormmcorelogin loginformerrorreasonbetplacementdatetime todate i18nmonthtranslatecommonapppwssubscriptionsdetailsremove translatemmcoreplayhistorydetaildgyourgridlnbcurrencyfalse commonheadertradingbalancetranslatedrawgamestatisticsdatelastdraw translatestarsresultsymbolstarsresultcountstarsresulttotalpercentagetranslatedrawgamesjackpotbaselinecommonheaderpromobalancetranslate commonapppwssubscriptionsdetailsdepositmoneyandactivate translatecommonapppwssubscriptionsdetailsmodifyctrlnextdrawjackpottranslate mmcoreregistrationformerrortranslateindexdatedrowpicksystemnamelastcomalesscomalessresulttotalcountresulttotalpercentage lnbpercentageresultlastdrawdate dateddmmyyyyresultdrawgapdrawgamestatisticsballtranslatenbsppwsregistrationrequiredtranslatecommonapppwssubscriptionsdetailsmodify translatecommonapppwssubscriptionsdetailsstoprdname1drawgamesjokerpluszodiacsign sign lowercasemmcorepersonaldetailspostcodeerrorinvalidtranslatemmcoreloginenteryourpassword translatepwsregistrationrequired translatecommonappcommonnewslettersubscriptioncaptchaisrequirednamei18ndayofweek translateaccountserviceaccountscreditpromobalance lnbcurrencyfalse commonheaderpromobalancepwsregistrationprofessionemployee translatectrlnextdrawdetailstsgetdaypwsregistrationusername translate0ctrlpicksystemstake lnbcurrencyfalsetranslatemmcoreloginenteryourpassword translatepwsregistrationrequiredtranslate mmcorecommonsave translatemmm yyyycommonapppwssubscriptionsdetailstotalstakelnbcurrencyfalseboardpicksystemname rowpicksystemnamelast index1pickvaluevaluepickvaluevaluepickvaluevalueboardstakehhmmssmmcoreplayhistorydetailsbchannel translatetranslateerrorpwsregistrationpasswordconfirmation translate pwsregistrationnotsamepasswordtranslate pwsregistrationpasswordconfirmation translatemmcorepersonaldetailssuccesstranslatepwsregistrationrequired translatecommonappcommonnewslettersubscriptioncaptchaisrequiredtranslatectrlnextdrawdetailsjackpot lnbnumber0translate drawgamesdrawpricestitledrawgamesaddontitle translatebetdetailsbethistorydatelnbdgcurrencyctrltiletargetmmcoreplayhistorydetaildgyourcombination translateindex1pickvaluevalueboardstake lnbcurrencyfalseboardpicksystemnamedrawgamesjackpotwinon translate ctrlnextdrawtsdrawgamesjackpotaroundctrlpicksystemmaxpickvaluestranslate drawgamesdrawpricesinfo translatedateddmmyyyyresultbiggestprize lnbdgcurrencyresultjackpottranslatedrawgameslastdrawresultwinnersinbelgium translatedrawgameslastdrawresultwinnersineuropexpwsregistrationregistertoplayonlinecommonmonth ctrlnextdrawdetailstsgetmonthhhmmssmmcoreplayhistorydetailsbchannel translate mmcoreplayhistorychannelbannertextbannershortdescriptiontranslate xtranslate pwsregistrationregistertoplayonline translatetranslate ctrlnextdrawjackpot lnbdgcurrency0drawgamesdrawpricesinfommcoreplayhistorydetailsbdescription betdetailsbettypename translatetwopointlesslnbcurrencyfalseboardpicksystemname rowpicksystemnamelastdrawdatemediumoksignwhitespaceextraresultshistoryjackpot lnbnumber0 lnbcurrencysymboldrawgamedrawgameresulthistorynowinnerctrltileexternalid translatectrlnextdrawdetailsjackpot lnbnumber0ctrlnextdrawdetailselotsomdetailsnumberofjackpotwinnersdrawgamesconfirmedit translatectrlnextdrawdetailselotsomdetailstotalorestimatedjackpottranslateerror commonappcommoncontactusunexpectederrortranslate drawgamesboardtitle translatectrlnextdrawtstranslatecommondaysofweektodate i18ndayofweekpwsregistrationnotvalidemaildrawgamesjackpottowin translatenbspbannertextnbspbannershortdescriptionmmcoreplayhistorydetailsbstakeafterdiscount translate mmcoreplayhistorydetailsbwinningshhmmssmmcoreplayhistorydetailsbchannelpwsregistrationphonenumber translatemmcoreplayhistorydetailsbtotaldiscounttranslatedrawgamestatisticscount translatedrawgamestatisticspercentage translatedrawgamestatisticsdatelastdrawtranslatemmcoreloginregisterhere translatebetplacementdatetimecommonappinfotexttranslateresultsymbol comalessresulttotalcountresulttotalpercentage lnbpercentageresultlastdrawdatetranslate betplacementdatetime todatetranslate mmcorecommonemailaddress translatepwsregistrationrequiredtranslatedrawgameslastdrawresultwinningstarsindex1pickvaluevaluepickvaluevaluepickvaluevalueboardstake lnbcurrencyfalseboardpicksystemname rowpicksystemnamelastpwsregistrationpasswordconfirmationeventdrawdate todatemmcoreplayhistorydetailsbstakeafterdiscount translatectrlgameid translatetranslate mmcoreplayhistorydetailsbstakeafterdiscountlivetranslate pwsregistrationstep2pwsregistrationnotstrongpassword translate pwsregistrationpasswordconfirmationegames ctrlannouncementgameiddrawgamesdrawpricestitle translatelnbdgcurrency0 drawgamesjackpottowincommonheadertradingbalancenbspselectionprice oddstranslateerror mmcorepersonaldetailssuccess translatebulltranslatemmcoreloginforgotpasswordcommonapppwssubscriptionsdetailsdepositmoneyandactivate translatecommonapppwssubscriptionsdetailsmodifytranslateresultdrawdatedateddmmyyyyresultdrawgapdrawgamestatisticsdate translatedrawgamestatisticsamountpwsregistrationregistertoplayonline translate pwsregistrationstep1translatedrawgamesjackpotbaseline ctrltileexternalid translatectrlnextdrawdetailsjackpotindex1pickvaluevaluepickvaluevaluepickvaluevalueboardstaketranslatedrawgameslastdrawresultwinnersineurope translatedrawgameslastdrawresultgainaccountserviceaccountscreditpromobalance lnbcurrencyfalsebull accountserviceaccountscreditpromobalance lnbcurrencyfalsepwsregistrationstep1translate pwsregistrationphonepatterntranslate bull accountserviceaccountscreditpromobalancebetidswbusinesschanneldateddmmyyyyresultdrawgapdrawgamestatisticsballmmcorecommonenteremailaddress translatepwsregistrationrequired translatepwsregistrationnotvalidemaildateddmmyyyyresultdrawgapdrawgamestatisticsdatemmcorecommonfiltertranslate mmcorecommonsavelnbdgcurrencyresulttotalwageramountlnbdgcurrencyresultjackpot lnbdgcurrencyresulttotalwageramount lnbdgcurrencydrawgamestatisticsdatetranslatedrawgamestatisticsdatelastdraw translateresultsymboltranslate drawgamesboardquickpick translatetranslate pwsregistrationregistrationnumber translatetranslate drawgamesdrawstitle translatei18nmonth translatetranslatedrawgamestatisticspercentagemmmtranslate pwsregistrationusernamemmcoreplayhistorydetailsbwinnings translatetodate datedd betplacementdatetimetranslatepwsregistrationrequiredlnbdgcurrencyresulttotalwageramount lnbdgcurrencydrawgamestatisticsdate translatedrawgamestatisticsamounttranslate pwsregistrationopenaccounttranslatedrawgameslastdrawresultwinningstars translatedrawgameslastdrawresultwinnerscommonapppwssubscriptionsdetailsdepositmoneyandactivate translatecommonapppwssubscriptionsdetailsmodify translatecommonapppwssubscriptionsdetailsstoppwsregistrationphonepattern translaterowpicksystemnamelast index1pickvaluevaluepickvaluevaluepickvaluevalueboardstakemmcorecommoncancel translate mmcorecommonfilterpwsregistrationregistrationnumber translate pwsregistrationopenaccountctrlnextdrawdetailstsgetfullyear drawgamesjackpotaroundpwsregistrationphonepatternctrlpicksystemmaxpickvalues ctrlpicksystemmaxextrapickvalues ctrlpicksystemstakewhitespaceextraresultshistoryjackpot lnbnumber0translatepwsregistrationpostcodei18ndayofweek translate eventdrawdatetranslate mmcorepersonaldetailslastnamedateddmmyyyydrawgamestatisticsball translatedrawgamestatisticscount translatedrawgamestatisticspercentagetranslatedrawgamestatisticspercentage translatedrawgamestatisticsdatelastdraw translatestarsresultsymbolstarsresultcountstarsresulttotalpercentagetranslatedrawgamestileelotsommessageonewinnercomalessresulttotalcountresulttotalpercentagetranslate mmcoreplayhistorydetailsbtotaldiscountnavigationitemtextvmuseremailctrlnextdrawdetailslegallevel ctrltileexternalid translatedrawgamestileelotsommessageonewinnertranslate pwsregistrationselectoneofmmm yyyycommonapppwssubscriptionsdetailstotalstake translatemmcorecommonenteremailaddress translatepwsregistrationrequiredctrlnextdrawdetailstsgetdate commonmonth ctrlnextdrawdetailstsgetmonthtranslatecommonappcommoncontactusunexpectederror translateerror commonappcommoncontactusunexpectederrortranslatedrawgamestatisticsamount translateresultdrawdatetranslatecommonappcommonnewslettersubscriptionsubscribeerror translateerrormmcoreloginmmcorelogintitlelnbcurrencyfalseboardpicksystemname rowpicksystemnamelast mmcoreplayhistorydetaildgyourcombinationtranslate mmcoreplayhistorydetailsbstakeafterdiscount translatetranslate mmcorelogintitletranslate bulltranslate ctrlnextdrawts drawdatemediumpwsregistrationpasswordconfirmation translatetranslate mmcoreplaylimitsremainingpwsregistrationregistrationnumber translatetranslateerror mmcoreregistrationformerror translatecurrentdetailtseventtime todatetranslateresultshistorydrawnnumbers comalessgamepricetranslate pwsregistrationnexttranslate pwsregistrationstep2 translatepwsregistrationselectoneofctrltileexternalid translatedrawgamestileelotsommessageonewinnercommonheadertradingbalance translate bullctrlnextdrawdetailstsgetfullyear drawgamesjackpotaround translatedrawgamesjackpotbaselinetranslatedrawgamestatisticspercentage translatedrawgamestatisticsdatelastdrawtranslatepwsregistrationrequired translatepwsregistrationnotvalidemailmenuitemtextrowpicksystemnamelast index1pickvaluevalueboardstake lnbcurrencyfalseboardpicksystemnamebannershortdescription bannertitle bannertexttranslate mmcoreplaylimitsremaining translatetranslatepwswalletsummaryvouchersvouchertranslatecommonappcommonnewslettersubscriptioncaptchaisrequiredtranslate mmcoreplayhistorydetailsbwinnings translatebannertext bannershortdescription bannertitletranslatedrawgameslastdrawresultwinners translatedrawgameslastdrawresultwinnersinbelgium translatedrawgameslastdrawresultwinnersineuropectrltileexternaliddrawgamesjackpotaround translatedrawgamesjackpotbaselinelnbpercentageresultlastdrawdate dateddmmyyyyresultdrawgapdrawgamestatisticsballctrlnextdrawdetailstsgetday translatedateddmmyyyyresultdrawgapdrawgamestatisticsball translatedrawgamestatisticscount translatedrawgamestatisticspercentagebannertitle bannertexttranslatectrlnextdrawdetailsjackpot lnbnumber0 lnbcurrencysymbolcurrentdetailtseventtimetodate dateyyyy hhmmssmmcoreplayhistorydetailsbchanneltranslatemmcoreloginenteryourpasswordtranslate mmcorecommonemailaddresstranslateindex 1pickvaluevaluepickvaluevaluepickvaluevaluepickvaluevaluepickvaluevaluegridpicksystemname rowpicksystemnamelastlnbdgcurrencyresultjackpot lnbdgcurrencyresulttotalwageramount lnbdgcurrencyeuromillionstarsresultssetmainnamedrawgamestatisticsballtranslate ctrlnextdrawdetailstsgetdatebannertext bannertitledrawgamesjackpotlegal ctrlnextdrawdetailslegallevel ctrltileexternalidloginformerrorreason translateerrortranslate drawgamesgamenamemmcorepersonaldetailspostcodeerrorinvalid translate pwsregistrationselectoneofloginformerrorreasondateddtranslatepwsregistrationnotvalidemail translatemmcoreloginenteryourpasswordtranslateerror mmcorecommonenteremailaddress translatepwsregistrationrequiredrowpicksystemnamelast mmcoreplayhistorydetaildgyourcombination translateindex1pickvaluevalueboardstaketranslate drawgamesboardtitlemmcorepersonaldetailserrormmcorepersonaldetailssuccess translatetodate datedtodate i18nmonth translatetranslatectrlnextdrawdetailsjackpottranslate commonapppwssubscriptionsdetailsdepositmoneyandactivatemmcoreplayhistorychannel betidswbusinesschanneli18nmonthpwsregistrationstep1 translate pwsregistrationstep2drawgamesjackpotaround translatedrawgamesjackpotbaseline ctrltileexternalidtranslateresultdrawdate dateddmmyyyyresultbiggestprizebannertextctrlpicksystemmaxpickvalues ctrlpicksystemmaxextrapickvaluesdrawgamescommondetails translatebannertitle bannertextbannershortdescriptionx xlnbcurrencyfalsecommonmenurightopenaccountbetplacementdatetime todate dateddcommonheadertradingbalance translatetranslatecommonapppwssubscriptionsdetailsremoverowpicksystemnamelast index1pickvaluevaluepickvaluevaluepickvaluevalueboardstake lnbcurrencyfalseboardpicksystemnameyyyycommonapppwssubscriptionsdetailstotalstakepwsregistrationselectoneof acrestranslate mmcorepersonaldetailslastname translatetranslate ctrlnextdrawdetailstsgetdate commonmonthtranslate pwsregistrationphonepattern translatepwsregistrationprofessionemployeectrlannouncementgameid name translatetranslatedrawgamestatisticsdatelastdraw translateresultsymbol comalessresulttotalcountresulttotalpercentagedateyyyy hhmmssmmcoreplayhistorydetailsbchannellnbdgcurrencydrawgamestatisticsdate translatedrawgamestatisticsamount translateresultdrawdateuppercasemmcoreregistrationformerror translatetranslateerrormmcoreloginwhitespaceextraresultshistoryjackpottranslatecommonappcommonnewslettersubscriptionsubscribeerrortranslateindex1pickvaluevalueboardstake lnbcurrencyfalseboardpicksystemname rowpicksystemnamelastpwsregistrationphonenumbertranslateerrormmcorelogin loginformerrorreason translateerrorlnbdgcurrencyresulttotalwageramount lnbdgcurrencyeuromillionstarsresultssetmainnamedrawgamestatisticsballtranslatepwsregistrationrequired translatecommonappcommonnewslettercontactupdatefirstnameerror translatelnbdgcurrencyresulttotalwageramount lnbdgcurrencydrawgamestatisticsdatetranslateresultshistorydrawnnumbers comaless twopointlesscommonapppwssubscriptionsdetailsactivate translate commonapppwssubscriptionsdetailsdepositmoneyandactivatectrlannouncementgameid namepwsregistrationrequired translate pwsregistrationnextpwsregistrationregistrationnumberdateddmmyyyydrawgamestatisticsballctrlnextdrawdetailselotsomdetailstotalorestimatedjackpot lnbnumber0pwsregistrationnextmmcorecommonemailaddress translatepwsregistrationrequiredlnbcurrencysymboldateddmmyyyyresultbiggestprize lnbdgcurrencyresultjackpot lnbdgcurrencyresulttotalwageramountcomalessresulttotalcountresulttotalpercentage lnbpercentageresultlastdrawdatepickvaluedrawgamesdrawpricestitle translate drawgamesdrawpricesinfotranslate pwsregistrationusername translatetranslateindex1pickvaluevalueboardstaketranslate drawgamesconfirmedittodatetranslate pwsregistrationprofessionemployeex ctrlnextdrawdetailselotsomdetailstotalorestimatedjackpottranslatecommonappcommoncontactusunexpectederrortranslate mmcoreregistrationformerror translatedateddmmyyyyresultbiggestprizedrawgamesboardyourgridsaccountserviceaccountscreditpromobalancepwsregistrationnotstrongpasswordtranslate nbsplnbdgcurrencyeuromillionstarsresultssetmainnamedrawgamestatisticsball translatedrawgamestatisticscountlnbdgcurrencyresulttotalwageramount lnbdgcurrencyeuromillionstarsresultssetmainnamedrawgamestatisticsball translatedrawgamestatisticscounttranslatedrawgamestatisticsdatelastdrawtranslate x xmmcoreplayhistorydetailsbwinningspwsregistrationstep2translate mmcoreplayhistorydetailsbtotaldiscount translatetranslatedrawgamestatisticsdatelastdraw translatestarsresultsymbolstarsresultcountstarsresulttotalpercentage lnbpercentagestarsresultlastdrawdatelnbcurrencysymboldrawgamedrawgameresulthistorynowinnerbannertitle bannertext bannertitlecomaless twopointless whitespaceextraresultshistoryjackpotpwsregistrationopenaccountuppercase nodeitemnametranslateresultdrawdate dateddmmyyyyresultbiggestprize lnbdgcurrencyresultjackpottranslate mmcoreplayhistorychanneldrawgamesdrawpricestitledrawgamesjackpotwinontranslate commonmenurightopenaccounttranslate pwsregistrationrequiredmmcoreplaylimitsremainingtranslate drawgamesdrawpricesinfotranslate eventdrawdatetranslate pwsregistrationnotvalidemaildrawgamesboardquickpicktodate dated mmmlnbdgcurrencyresultjackpotdrawgamesjackpottowintranslatedrawgameslastdrawresultwinnersdated mmmmmcoreplayhistorychanneldrawgamesjokerpluszodiacsigntranslate commonappinfotext translatetranslate mmcoreplayhistorydetailsbwinningstranslatestarsresultsymbolstarsresultcountstarsresulttotalpercentage lnbpercentagestarsresultlastdrawdatepwsregistrationregistertoplayonline translatetranslate commonappinfotextctrlgameidtranslatedrawgamesjackpotbaseline ctrltileexternalidcommonmonth ctrlnextdrawdetailstsgetmonth translatemmcorepersonaldetailslastname translatetranslateerrormmcorelogin loginformerrorreasonrowpicksystemnamelast index1pickvaluevalueboardstaketwopointless whitespaceextraresultshistoryjackpot lnbnumber0drawgamesboardtitle translate drawgamesdrawstitlecommondaysofweekdrawgamescommondetails translate drawgamescommondetailsbannertitle nbspbannertextnbspbannershortdescription bannertitletranslatedrawgamestatisticsamounttranslatepwsregistrationnotvalidemail translatemmcoreloginenteryourpassword translatepwsregistrationrequireddrawdatemedium drawgamesjackpotwinon translatectrlnextdrawjackpot lnbdgcurrency0 drawgamesjackpottowinmmcorecommonenteremailaddresstranslate ctrlnextdrawtsindex1pickvaluevaluepickvaluevaluepickvaluevalueboardstake lnbcurrencyfalseboardpicksystemname

Longtail Keyword Density for E-lotto.be

KeywordsOccurences
translate pwsregistrationrequired translate38
translatedrawgamestatisticscount translatedrawgamestatisticspercentage translatedrawgamestatisticsdatelastdraw19
bannertitle nbspbannertextnbspbannershortdescription bannertitle18
nbspbannertextnbspbannershortdescription bannertitle nbspbannertextnbspbannershortdescription16
translatedrawgamestatisticspercentage translatedrawgamestatisticsdatelastdraw translateresultsymbol11
translatedrawgamestatisticsdatelastdraw translateresultsymbol comalessresulttotalcountresulttotalpercentage11
translateresultsymbol comalessresulttotalcountresulttotalpercentage lnbpercentageresultlastdrawdate11
bannertitle bannertext bannershortdescription10
translate mmcorecommonsave translate9
bannertext bannershortdescription bannertitle9
bannershortdescription bannertitle bannertext9
translate ctrlnextdrawts drawdatemedium7
translate drawgamesdrawstitle translate7
translate drawgamesconfirmedit translate7
dateddmmyyyyresultdrawgapdrawgamestatisticsball translatedrawgamestatisticscount translatedrawgamestatisticspercentage6
todate i18ndayofweek translate6
comalessresulttotalcountresulttotalpercentage lnbpercentageresultlastdrawdate dateddmmyyyyresultdrawgapdrawgamestatisticsball6
lnbpercentageresultlastdrawdate dateddmmyyyyresultdrawgapdrawgamestatisticsball translatedrawgamestatisticscount6
selectionprice odds 26
translate mmcoreregistrationformerror translate6
translateindex1pickvaluevalueboardstake lnbcurrencyfalseboardpicksystemname rowpicksystemnamelast6
translate betplacementdatetime todate6
translateerror mmcoreregistrationformerror translate6
todate i18nmonth translate5
translate mmcoreplaylimitscancel-changes translate5
todate dateddmmyyyy hhmmss5
translateresultdrawdate dateddmmyyyyresultbiggestprize lnbdgcurrencyresultjackpot5
dateddmmyyyyresultbiggestprize lnbdgcurrencyresultjackpot lnbdgcurrencyresulttotalwageramount5
translate drawgamesboardtitle translate5
translate drawgamescommondetails translate5
translate pwsregistrationphonepattern translate5
translatedrawgamestatisticsamount translateresultdrawdate dateddmmyyyyresultbiggestprize5
drawgamesjackpotwin-on translate ctrlnextdrawts5
whitespaceextraresultshistoryjackpot lnbnumber0 lnbcurrencysymboldrawgamedrawgameresulthistorynowinner4
mmcorecommonenter-email-address translatepwsregistrationrequired translatepwsregistrationnotvalidemail4
translateerror mmcorecommonenter-email-address translatepwsregistrationrequired4
drawgamescommondetails translate drawgamescommondetails4
translateerror commonappcommoncontactus-unexpectederror translateerror4
comaless twopointless whitespaceextraresultshistoryjackpot4
drawdatemedium drawgamesjackpotwin-on translate4
ctrlnextdrawts drawdatemedium drawgamesjackpotwin-on4
translate commonappinfotext translate4
translate mmcorecommoncancel translate4
translateresultshistorydrawnnumbers comaless twopointless4
loginformerrorreason translateerror mmcorecommonenter-email-address4
translateerrormmcorelogin loginformerrorreason translateerror4
translate pwsregistrationregistertoplayonline translate4
i18ndayofweek translate eventdrawdate4
translate eventdrawdate todate4
translateindex 1pickvaluevaluepickvaluevaluepickvaluevaluepickvaluevaluepickvaluevaluegridpicksystemname rowpicksystemnamelast4
pwsregistrationregistertoplayonline translate pwsregistrationstep14
translate mmcoreplayhistorychannel betidswbusinesschannel4
translate pwsregistrationusername translate4
translate pwsregistrationstep2 translate4
pwsregistrationstep1 translate pwsregistrationstep24
translate pwsregistrationstep1 translate4
translate pwsregistrationregistrationnumber translate4
twopointless whitespaceextraresultshistoryjackpot lnbnumber04
translate mmcorepersonaldetailspost-codeerror-invalid translate4
translatecommonappcommoncontactus-unexpectederror translateerror commonappcommoncontactus-unexpectederror4
pwsregistrationregistrationnumber translate pwsregistrationopenaccount4
translate pwsregistrationopenaccount translate4
pwsregistrationrequired translate mmcorepersonaldetailspost-codeerror-invalid4
translatedrawgamestatisticspercentage translatedrawgamestatisticsdatelastdraw translatestarsresultsymbolstarsresultcountstarsresulttotalpercentage4
translatedrawgamestatisticsdatelastdraw translatestarsresultsymbolstarsresultcountstarsresulttotalpercentage lnbpercentagestarsresultlastdrawdate4
pwsregistrationopenaccount translate x4
translate drawgamesdrawpricestitle translate3
drawgamesdrawpricestitle translate drawgamesdrawpricesinfo3
translate drawgamesdrawpricesinfo translate3
pwsregistrationrequired translate pwsregistrationnext3
translate drawgamesboardquickpick translate3
drawgamesboardtitle translate drawgamesdrawstitle3
egames ctrlannouncementgameid name3
commonapppwssubscriptionsdetails-activate translate commonapppwssubscriptionsdetails-depositmoneyandactivate3
mmm yyyycommonapppwssubscriptionsdetails-totalstake translate3
ctrlannouncementgameid name translate3
translate commonapppwssubscriptionsdetails-depositmoneyandactivate translatecommonapppwssubscriptionsdetails-modify3
commonapppwssubscriptionsdetails-depositmoneyandactivate translatecommonapppwssubscriptionsdetails-modify translatecommonapppwssubscriptionsdetails-stop3
translatecommonapppwssubscriptionsdetails-stop translatecommonapppwssubscriptionsdetails-remove translatemmcoreplayhistorydetaildgyour-grid3
translatecommonapppwssubscriptionsdetails-modify translatecommonapppwssubscriptionsdetails-stop translatecommonapppwssubscriptionsdetails-remove3
translate pwsregistrationnext translate3
translate egames ctrlannouncementgameid3
translate pwsregistrationprofessionemployee translate3
translatedrawgamedrawgameresulthistorydrawdatetranslatedrawgamedrawgameresulthistorydrawnumberstranslatedrawgamedrawgameresulthistorywinningtranslateresultshistorydrawdatedrawgamedrawgameresulthistorynodrawnumber translateresultshistorydrawnnumbers comaless3
lnbdgcurrencydrawgamestatisticsdate translatedrawgamestatisticsamount translateresultdrawdate3
dated mmm yyyycommonapppwssubscriptionsdetails-totalstake3
lnbdgcurrencyresultjackpot lnbdgcurrencyresulttotalwageramount lnbdgcurrencyeuromillionstarsresultssetmainnamedrawgamestatisticsball3
ctrlnextdrawjackpot lnbdgcurrency0 drawgamesjackpotto-win3
lnbdgcurrencyresulttotalwageramount lnbdgcurrencydrawgamestatisticsdate translatedrawgamestatisticsamount3
dateddmmyyyyresultdrawgapdrawgamestatisticsdate translatedrawgamestatisticsamount translateresultdrawdate3
translate ctrlnextdrawjackpot lnbdgcurrency03
lnbdgcurrencyresultjackpot lnbdgcurrencyresulttotalwageramount lnbdgcurrencydrawgamestatisticsdate3
lnbdgcurrencyresulttotalwageramount lnbdgcurrencyeuromillionstarsresultssetmainnamedrawgamestatisticsball translatedrawgamestatisticscount3
translatedrawgameslastdrawresultwinners-in-belgium translatedrawgameslastdrawresultwinners-in-europe translatedrawgameslastdrawresultgain3
bannertitle bannertext bannertitle3
ctrlpicksystemmaxpickvalues ctrlpicksystemmaxextrapickvalues ctrlpicksystemstake3
lnbpercentageresultlastdrawdate dateddmmyyyyresultdrawgapdrawgamestatisticsdate translatedrawgamestatisticsamount3
dateddmmyyyydrawgamestatisticsball translatedrawgamestatisticscount translatedrawgamestatisticspercentage3
lnbdgcurrencyeuromillionstarsresultssetmainnamedrawgamestatisticsball translatedrawgamestatisticscount translatedrawgamestatisticspercentage3
translatedrawgameslastdrawresultwinners translatedrawgameslastdrawresultwinners-in-belgium translatedrawgameslastdrawresultwinners-in-europe3
translatedrawgameslastdrawresultwinning-stars translatedrawgameslastdrawresultwinners translatedrawgameslastdrawresultwinners-in-belgium3
drawgamesjokerpluszodiacsign sign lowercase3
ctrlpicksystemmaxextrapickvalues ctrlpicksystemstake lnbcurrencyfalse3
dateyyyy hhmmssmmcoreplayhistorydetailsbchannel translate3
translate pwsregistrationselectoneof acres3
ctrlnextdrawdetailstsgetday translate ctrlnextdrawdetailstsgetdate3
translate ctrlnextdrawdetailstsgetdate commonmonth3
mmcorepersonaldetailspost-codeerror-invalid translate pwsregistrationselectoneof3
translate pwsregistrationnotsamepassword translate3
translate pwsregistrationpasswordconfirmation translate3
pwsregistrationpasswordconfirmation translate pwsregistrationnotsamepassword3
ctrlnextdrawdetailstsgetdate commonmonth ctrlnextdrawdetailstsgetmonth3
commonmonth ctrlnextdrawdetailstsgetmonth translate3
translatedrawgamesjackpotbaseline ctrltileexternalid translatectrlnextdrawdetailsjackpot3
ctrltileexternalid translatectrlnextdrawdetailsjackpot lnbnumber03
translatectrlnextdrawdetailsjackpot lnbnumber0 lnbcurrencysymbol3
drawgamesjackpotaround translatedrawgamesjackpotbaseline ctrltileexternalid3
ctrlnextdrawdetailstsgetfullyear drawgamesjackpotaround translatedrawgamesjackpotbaseline3
ctrlnextdrawdetailstsgetmonth translate ctrlnextdrawdetailstsgetfullyear3
translate ctrlnextdrawdetailstsgetfullyear drawgamesjackpotaround3
pwsregistrationnotstrongpassword translate pwsregistrationpasswordconfirmation3
translate pwsregistrationnotstrongpassword translate3
translatecommonappcommonnewslettersubscriptionsubscribe-error translateerrormmcorelogin loginformerrorreason3
translatepwsregistrationrequired translatepwsregistrationnotvalidemail translatemmcoreloginenter-your-password3
translatepwsregistrationnotvalidemail translatemmcoreloginenter-your-password translatepwsregistrationrequired3
translate mmcorecommonemail-address translatepwsregistrationrequired3
mmcorepersonaldetailslast-name translate pwsregistrationrequired3
translatecommonappcommonnewslettercontactupdate-firstnameerror translate mmcorepersonaldetailslast-name3
translate mmcorepersonaldetailslast-name translate3
translatemmcoreloginenter-your-password translatepwsregistrationrequired translatecommonappcommonnewslettersubscription-captchaisrequired3
lnbcurrencyfalse commonheadertradingbalance translate3
translateerror mmcorepersonaldetailssuccess translate3
translate x x3
pwsregistrationrequired translate pwsregistrationnotstrongpassword3
accountserviceaccountscreditpromobalance lnbcurrencyfalse commonheaderpromobalance3
bull accountserviceaccountscreditpromobalance lnbcurrencyfalse3
commonheadertradingbalance translate bull3
translate bull accountserviceaccountscreditpromobalance3
ctrlnextdrawdetailselotsomdetailsnumberofjackpotwinners x ctrlnextdrawdetailselotsomdetailstotalorestimatedjackpot3
x ctrlnextdrawdetailselotsomdetailstotalorestimatedjackpot lnbnumber03
todate dateyyyy hhmmssmmcoreplayhistorydetailsbchannel3
translatepwsregistrationrequired translatecommonappcommonnewslettercontactupdate-firstnameerror translate3
hhmmssmmcoreplayhistorydetailsbchannel translate mmcoreplayhistorychannel3
betplacementdatetime todate dateyyyy3
i18nmonth translate betplacementdatetime3
datedd betplacementdatetime todate3
betplacementdatetime todate i18nmonth3
translate mmcoreplayhistorydetailsbtotal-discount translate3
mmcoreplayhistorydetailsbtotal-discount translate mmcoreplayhistorydetailsbstake-after-discount3
pwsregistrationphonepattern translate pwsregistrationphonenumber3
translate pwsregistrationphonenumber translate3
translate mmcoreplaylimitsremaining translate3
eventdrawdate todate dateddmmyyyy3
translate mmcoreplayhistorydetailsbwinnings translate3
translate mmcoreplayhistorydetailsbstake-after-discount translate3
mmcoreplayhistorydetailsbstake-after-discount translate mmcoreplayhistorydetailsbwinnings3
todate datedd betplacementdatetime3
betplacementdatetime todate datedd3
ctrlnextdrawdetailslegallevel ctrltileexternalid translatedrawgamestileelotsommessageonewinner3
mmcorecommoncancel translate mmcorecommonfilter3
lnbcurrencyfalseboardpicksystemname rowpicksystemnamelast index1pickvaluevaluepickvaluevaluepickvaluevalueboardstake3
drawgamesjackpotlegal ctrlnextdrawdetailslegallevel ctrltileexternalid3
lnbcurrencysymbol drawgamesjackpotlegal ctrlnextdrawdetailslegallevel3
ctrlnextdrawdetailselotsomdetailstotalorestimatedjackpot lnbnumber0 lnbcurrencysymbol3
lnbnumber0 lnbcurrencysymbol drawgamesjackpotlegal3
rowpicksystemnamelast index1pickvaluevaluepickvaluevaluepickvaluevalueboardstake lnbcurrencyfalseboardpicksystemname3
index1pickvaluevaluepickvaluevaluepickvaluevalueboardstake lnbcurrencyfalseboardpicksystemname rowpicksystemnamelast3
rowpicksystemnamelast mmcoreplayhistorydetaildgyour-combination translateindex1pickvaluevalueboardstake3
mmcoreplayhistorydetaildgyour-combination translateindex1pickvaluevalueboardstake lnbcurrencyfalseboardpicksystemname3
lnbcurrencyfalseboardpicksystemname rowpicksystemnamelast mmcoreplayhistorydetaildgyour-combination3
index1pickvaluevalueboardstake lnbcurrencyfalseboardpicksystemname rowpicksystemnamelast3
lnbcurrencyfalseboardpicksystemname rowpicksystemnamelast index1pickvaluevalueboardstake3
rowpicksystemnamelast index1pickvaluevalueboardstake lnbcurrencyfalseboardpicksystemname3
todate dated mmm3
translate pwsregistrationrequired43
pwsregistrationrequired translate38
translatedrawgamestatisticspercentage translatedrawgamestatisticsdatelastdraw19
translatedrawgamestatisticscount translatedrawgamestatisticspercentage19
bannertitle nbspbannertextnbspbannershortdescription18
nbspbannertextnbspbannershortdescription bannertitle18
mmcoreregistrationformerror translate17
todate dateddmmyyyy14
bannertitle bannertext13
comalessresulttotalcountresulttotalpercentage lnbpercentageresultlastdrawdate12
lnbcurrencyfalseboardpicksystemname rowpicksystemnamelast12
translatedrawgamestatisticsdatelastdraw translateresultsymbol11
mmcorecommonsave translate11
translateresultsymbol comalessresulttotalcountresulttotalpercentage11
bannertext bannershortdescription10
translate mmcorecommonsave9
bannershortdescription bannertitle9
translate nbsp9
betplacementdatetime todate9
eventdrawdate todate8
ctrlnextdrawts drawdatemedium7
translate ctrlnextdrawts7
drawgamesdrawstitle translate7
drawgamesconfirmedit translate7
translate drawgamesdrawstitle7
translate drawgamesconfirmedit7
translatecommonappcommoncontactus-unexpectederror translateerror6
translate x6
i18ndayofweek translate6
lnbdgcurrencyresultjackpot lnbdgcurrencyresulttotalwageramount6
translatedrawgamestatisticsamount translateresultdrawdate6
translateerror mmcoreregistrationformerror6
selectionprice odds6
lnbnumber0 lnbcurrencysymbol6
translate vmuserfirstname6
translatepwsregistrationrequired translatepwsregistrationnotvalidemail6
lnbpercentageresultlastdrawdate dateddmmyyyyresultdrawgapdrawgamestatisticsball6
translate betplacementdatetime6
todate i18ndayofweek6
odds 26
dateddmmyyyyresultdrawgapdrawgamestatisticsball translatedrawgamestatisticscount6
translateindex1pickvaluevalueboardstake lnbcurrencyfalseboardpicksystemname6
mmcorecommoncancel translate6
translate mmcoreregistrationformerror6
pwsregistrationphonepattern translate6
comaless twopointless6
translate commonappinfotext6
drawgamesboardtitle translate5
todate dateyyyy5
translate pwsregistrationphonepattern5
rowpicksystemnamelast mmcoreplayhistorydetaildgyour-combination5
todate datedd5
todate i18nmonth5
i18nmonth translate5
drawgamescommondetails translate5
translate drawgamescommondetails5
dateddmmyyyyresultbiggestprize lnbdgcurrencyresultjackpot5
translateresultdrawdate dateddmmyyyyresultbiggestprize5
translate drawgamesboardtitle5
translate mmcoreplaylimitscancel-changes5
translate egames5
translate mmcorepersonaldetailspost-codeerror-invalid5
name translate5
drawgamesjackpotwin-on translate5
mmcoreplaylimitscancel-changes translate5
loginformerrorreason translateerror5
dateddmmyyyy hhmmss5
translateerror mmcorecommonenter-email-address4
mmcorecommonenter-email-address translatepwsregistrationrequired4
lnbnumber0 lnbcurrencysymboldrawgamedrawgameresulthistorynowinner4
whitespaceextraresultshistoryjackpot lnbnumber04
twopointless whitespaceextraresultshistoryjackpot4
translateresultshistorydrawnnumbers comaless4
translatemmcoreloginregisterhere translate4
1pickvaluevaluepickvaluevaluepickvaluevaluepickvaluevaluepickvaluevaluegridpicksystemname rowpicksystemnamelast4
translatepwsregistrationrequired translatecommonappcommonnewslettersubscription-captchaisrequired4
translateerrormmcorelogin loginformerrorreason4
translate pwsregistrationnotvalidemail4
translateindex 1pickvaluevaluepickvaluevaluepickvaluevaluepickvaluevaluepickvaluevaluegridpicksystemname4
translate pwsregistrationregistertoplayonline4
translate eventdrawdate4
pwsregistrationregistertoplayonline translate4
mmcoreplayhistorychannel betidswbusinesschannel4
translate mmcoreplayhistorychannel4
pwsregistrationstep1 translate4
pwsregistrationstep2 translate4
translatepwsregistrationrequired translate4
mmcorecommonemail-address translatepwsregistrationrequired4
translate pwsregistrationstep24
pwsregistrationnext translate4
translateerror commonappcommoncontactus-unexpectederror4
translate pwsregistrationstep14
pwsregistrationusername translate4
pwsregistrationopenaccount translate4
commonappcommoncontactus-unexpectederror translateerror4
mmcorepersonaldetailspost-codeerror-invalid translate4
ctrlgameid translate4
translatestarsresultsymbolstarsresultcountstarsresulttotalpercentage lnbpercentagestarsresultlastdrawdate4
translatedrawgamestatisticsdatelastdraw translatestarsresultsymbolstarsresultcountstarsresulttotalpercentage4
translate pwsregistrationopenaccount4
menuitemtext menuitemtext4
pwsregistrationregistrationnumber translate4
translate mmcorecommoncancel4
translate pwsregistrationusername4
mmcorepersonaldetailssuccess translate4
drawdatemedium drawgamesjackpotwin-on4
translate pwsregistrationregistrationnumber4
commonappinfotext translate4
pwsregistrationprofessionemployee translate3
uppercase nodeitemname3
translate pwsregistrationnext3
bannertext bannertitle3
translate pwsregistrationprofessionemployee3
bannertitle bannertextbannershortdescription3
drawgamesjokerpluszodiacsign sign3
lnbdgcurrencydrawgamestatisticsdate translatedrawgamestatisticsamount3
ctrlnextdrawjackpot lnbdgcurrency03
lnbdgcurrency0 drawgamesjackpotto-win3
translate ctrlnextdrawjackpot3
drawgamesaddontitle translate3
translate drawgamesboardquickpick3
drawgamesboardquickpick translate3
translate drawgamesgame-name3
translatedrawgamedrawgameresulthistorydrawdatetranslatedrawgamedrawgameresulthistorydrawnumberstranslatedrawgamedrawgameresulthistorywinningtranslateresultshistorydrawdatedrawgamedrawgameresulthistorynodrawnumber translateresultshistorydrawnnumbers3
egames ctrlannouncementgameid3
ctrlannouncementgameid name3
ctrlpicksystemstake lnbcurrencyfalse3
ctrlpicksystemmaxextrapickvalues ctrlpicksystemstake3
ctrlpicksystemmaxpickvalues ctrlpicksystemmaxextrapickvalues3
drawgamesdrawpricesinfo translate3
translate drawgamesdrawpricesinfo3
lnbpercentageresultlastdrawdate dateddmmyyyyresultdrawgapdrawgamestatisticsdate3
dateddmmyyyyresultdrawgapdrawgamestatisticsdate translatedrawgamestatisticsamount3
translatedrawgameslastdrawresultwinners-in-europe translatedrawgameslastdrawresultgain3
translatedrawgameslastdrawresultwinners-in-belgium translatedrawgameslastdrawresultwinners-in-europe3
translatedrawgameslastdrawresultwinning-stars translatedrawgameslastdrawresultwinners3
translatedrawgameslastdrawresultwinners translatedrawgameslastdrawresultwinners-in-belgium3
lnbdgcurrencyresulttotalwageramount lnbdgcurrencydrawgamestatisticsdate3
lnbdgcurrencyresulttotalwageramount lnbdgcurrencyeuromillionstarsresultssetmainnamedrawgamestatisticsball3
translate drawgamesdrawpricestitle3
drawgamesdrawpricestitle translate3
drawgamesboardyourgrids translate3
dateddmmyyyydrawgamestatisticsball translatedrawgamestatisticscount3
lnbdgcurrencyeuromillionstarsresultssetmainnamedrawgamestatisticsball translatedrawgamestatisticscount3
sign lowercase3
translate mmcoreplayhistorydetailsbstake-after-discount3
translate pwsregistrationselectoneof3
pwsregistrationselectoneof acres3
translate commonapploadmore3
pwsregistrationnotsamepassword translate3
translate pwsregistrationnotsamepassword3
pwsregistrationnotstrongpassword translate3
translate pwsregistrationpasswordconfirmation3
pwsregistrationpasswordconfirmation translate3
ctrlnextdrawdetailstsgetday translate3
translate ctrlnextdrawdetailstsgetdate3
drawgamesjackpotaround translatedrawgamesjackpotbaseline3
translatedrawgamesjackpotbaseline ctrltileexternalid3
ctrltileexternalid translatectrlnextdrawdetailsjackpot3
ctrlnextdrawdetailstsgetfullyear drawgamesjackpotaround3
translate ctrlnextdrawdetailstsgetfullyear3
ctrlnextdrawdetailstsgetdate commonmonth3
commonmonth ctrlnextdrawdetailstsgetmonth3
ctrlnextdrawdetailstsgetmonth translate3
translate pwsregistrationnotstrongpassword3
x x3
translate commonmenurightopenaccount3
translatecommonappcommonnewslettersubscriptionsubscribe-error translateerrormmcorelogin3
translatepwsregistrationnotvalidemail translatemmcoreloginenter-your-password3
translate mmcorecommonemail-address3
mmcorepersonaldetailslast-name translate3
translatepwsregistrationrequired translatecommonappcommonnewslettercontactupdate-firstnameerror3
translatecommonappcommonnewslettercontactupdate-firstnameerror translate3
translate mmcorepersonaldetailslast-name3
translatemmcoreloginenter-your-password translatepwsregistrationrequired3
lnbcurrencyfalse commonheadertradingbalance3
translate mmcorelogintitle3
translate mmcoreloginnoaccount3
translateerror mmcorepersonaldetailssuccess3
lnbcurrencyfalse commonheaderpromobalance3
accountserviceaccountscreditpromobalance lnbcurrencyfalse3
commonheadertradingbalance translate3
translate bull3
bull accountserviceaccountscreditpromobalance3
translatectrlnextdrawdetailsjackpot lnbnumber03
ctrlnextdrawdetailselotsomdetailsnumberofjackpotwinners x3
pwsregistrationphonenumber translate3
translate mmcoreplaylimitsremaining3
mmcoreplaylimitsremaining translate3
translate pwsregistrationphonenumber3
mmcoreplayhistorydetailsbdescription betdetailsbettype3
mmcoreplayhistorydetailsbwinnings translate3
betdetailsbethistorydate todate3
currentdetailtseventtime todate3
todate dated3
dated mmm3
commonapppwssubscriptionsdetails-depositmoneyandactivate translatecommonapppwssubscriptionsdetails-modify3
translatecommonapppwssubscriptionsdetails-modify translatecommonapppwssubscriptionsdetails-stop3
translatecommonapppwssubscriptionsdetails-stop translatecommonapppwssubscriptionsdetails-remove3
translate commonapppwssubscriptionsdetails-depositmoneyandactivate3
commonapppwssubscriptionsdetails-activate translate3
mmm yyyycommonapppwssubscriptionsdetails-totalstake3
yyyycommonapppwssubscriptionsdetails-totalstake translate3
lnbcurrencyfalsecommonapppwssubscriptionsdetails-status translate3
translate mmcoreplayhistorydetailsbwinnings3
mmcoreplayhistorydetailsbstake-after-discount translate3
ctrltileexternalid translatedrawgamestileelotsommessageonewinner3
drawgamesjackpotto-win translate3
translate mmcorecommonfilter3
ctrlnextdrawdetailslegallevel ctrltileexternalid3
drawgamesjackpotlegal ctrlnextdrawdetailslegallevel3
x ctrlnextdrawdetailselotsomdetailstotalorestimatedjackpot3
ctrlnextdrawdetailselotsomdetailstotalorestimatedjackpot lnbnumber03
lnbcurrencysymbol drawgamesjackpotlegal3
rowpicksystemnamelast index1pickvaluevaluepickvaluevaluepickvaluevalueboardstake3
index1pickvaluevaluepickvaluevaluepickvaluevalueboardstake lnbcurrencyfalseboardpicksystemname3
hhmmssmmcoreplayhistorydetailsbchannel translate3
translate mmcoreplayhistorydetailsbtotal-discount3
mmcoreplayhistorydetailsbtotal-discount translate3
dateyyyy hhmmssmmcoreplayhistorydetailsbchannel3
datedd betplacementdatetime3
rowpicksystemnamelast index1pickvaluevalueboardstake3
index1pickvaluevalueboardstake lnbcurrencyfalseboardpicksystemname3
mmcoreplayhistorydetaildgyour-combination translateindex1pickvaluevalueboardstake3
translatecommonapppwssubscriptionsdetails-remove translatemmcoreplayhistorydetaildgyour-grid3
translate857
todate54
translateerror49
pwsregistrationrequired43
bannertitle35
lnbcurrencyfalse19
translatedrawgamestatisticscount19
translatedrawgamestatisticsdatelastdraw19
translatedrawgamestatisticspercentage19
nbspbannertextnbspbannershortdescription18
translatepwsregistrationrequired18
mmcoreregistrationformerror17
rowpicksystemnamelast16
x16
lnbpercentageresultlastdrawdate16
dateddmmyyyy16
nbsp14
bannertext13
lnbcurrencyfalseboardpicksystemname12
comalessresulttotalcountresulttotalpercentage12
translateresultsymbol11
navigationitemtext11
mmcorecommonsave11
lnbnumber010
bannershortdescription10
betplacementdatetime9
translateindex8
eventdrawdate8
lnbdgcurrency8
ctrlgameid8
drawgamesdrawstitle7
translatepwsregistrationnotvalidemail7
07
drawdatemedium7
drawgamesconfirmedit7
ctrlnextdrawts7
datedd7
lnbdgcurrency07
menuitemtext6
lnbcurrencysymbol6
name6
egames6
drawgamesgame-name6
twopointless6
comaless6
mmcorecommoncancel6
commonappinfotext6
pwsregistrationphonepattern6
ctrltileexternalid6
vmuserfirstname6
selectionprice6
odds6
dateddmmyyyyresultdrawgapdrawgamestatisticsball6
translatedrawgamestatisticsamount6
lnbdgcurrencyresulttotalwageramount6
lnbdgcurrencyresultjackpot6
translateresultdrawdate6
translateindex1pickvaluevalueboardstake6
i18ndayofweek6
translatecommonappcommoncontactus-unexpectederror6
commonmonth6
drawgamesjackpotaround5
drawgamesjackpotto-win5
drawgamesboardtitle5
dateyyyy5
dateddmmyyyyresultbiggestprize5
i18nmonth5
loginformerrorreason5
mmcoreplayhistorydetaildgyour-combination5
mmcorepersonaldetailspost-codeerror-invalid5
drawgamesjackpotwin-on5
hhmmss5
mmcoreplaylimitscancel-changes5
drawgamescommondetails5
mmcorepersonaldetailserror4
mmcorepersonaldetailssuccess4
vmuseremail4
translatedrawgamesjackpotbaseline4
pwsregistrationstep14
pwsregistrationregistertoplayonline4
pwsregistrationstep24
pwsregistrationnext4
pwsregistrationregistrationnumber4
lowercase4
translatecommonappcommonnewslettersubscription-captchaisrequired4
pwsregistrationnotvalidemail4
cleanqp4
mmcorecommonemail-address4
translateresultshistorydrawnnumbers4
lnbcurrencysymboldrawgamedrawgameresulthistorynowinner4
whitespaceextraresultshistoryjackpot4
translatecommonappcommonnewslettersubscriptionsubscribe-error4
translateerrormmcorelogin4
translatemmcoreloginsubmit4
translatemmcoreloginregisterhere4
1pickvaluevaluepickvaluevaluepickvaluevaluepickvaluevaluepickvaluevaluegridpicksystemname4
mmcorecommonenter-email-address4
lnbpercentagestarsresultlastdrawdate4
translatestarsresultsymbolstarsresultcountstarsresulttotalpercentage4
rdname14
pwsregistrationusername4
translatecommondaysofweek4
playlimitsservicemaxdepositamount4
commonappcommoncontactus-unexpectederror4
translatemmcorepersonaldetailsfirst-name4
ctrltiletarget4
pwsregistrationopenaccount4
uppercase4
mmcoreplayhistorychannel4
betidswbusinesschannel4
ctrlnextdrawdetailstsgetday3
translatectrlnextdrawdetailsjackpot3
dateddmmyyyydrawgamestatisticsball3
lnbdgcurrencyeuromillionstarsresultssetmainnamedrawgamestatisticsball3
ctrlpicksystemstake3
ctrlnextdrawdetailstsgetdate3
ctrlpicksystemmaxextrapickvalues3
drawgamesdrawpricestitle3
drawgamesboardyourgrids3
isphone3
gameprice3
dateddmmyyyyresultdrawgapdrawgamestatisticsdate3
ctrlannouncementgameid3
translatemmcoreloginforgotpassword3
acres3
mmcorecommonfilter3
translatemmcoreloginenter-your-password3
lnbdgcurrencydrawgamestatisticsdate3
gamename3
commonapploadmore3
drawgamesdrawpricesinfo3
ctrlnextdrawdetailstsgetmonth3
translatedrawgamesbreabcrumbs3
drawgamesjackpotlegal3
ctrlnextdrawjackpot3
ctrlnextdrawdetailslegallevel3
translatedrawgamedrawgameresulthistorydrawdatetranslatedrawgamedrawgameresulthistorydrawnumberstranslatedrawgamedrawgameresulthistorywinningtranslateresultshistorydrawdatedrawgamedrawgameresulthistorynodrawnumber3
ctrlnextdrawdetailselotsomdetailstotalorestimatedjackpot3
ctrlnextdrawdetailselotsomdetailsnumberofjackpotwinners3
translatecommonappcommonnewslettercontactupdate-firstnameerror3
mmcorepersonaldetailslast-name3
online3
translatedrawgamestileelotsommessageonewinner3
ctrlpicksystemmaxpickvalues3
ok3
drawgamesboardquickpick3
pwsregistrationselectoneof3
commondaysofweek3
commonmenurightopenaccount3
drawgamesaddontitle3
pickvalue3
ctrlnextdrawdetailstsgetfullyear3
accountserviceaccountscreditpromobalance3
commonapppwssubscriptionsdetails-depositmoneyandactivate3
commonapppwssubscriptionsdetails-activate3
lnbcurrencyfalsecommonapppwssubscriptionsdetails-status3
yyyycommonapppwssubscriptionsdetails-totalstake3
translatecommonapppwssubscriptionsdetails-modify3
translatecommonapppwssubscriptionsdetails-stop3
pwsregistrationpasswordconfirmation3
translatepwswalletsummaryvouchersvoucher3
translatemmcoreplayhistorydetaildgyour-grid3
translatecommonapppwssubscriptionsdetails-remove3
mmm3
dated3
mmcoreplayhistorydetailsbdescription3
currentdetailtseventtime3
translatemmcoreplayhistorytableheaderstatus3
betdetailsbethistorydate3
betdetailsbettype3
translatenbsppwsregistrationrequired3
pwsregistrationnotstrongpassword3
mmcoreplaylimitsremaining3
pwsregistrationphonenumber3
mmcoreplayhistorydetailsbwinnings3
mmcoreplayhistorydetailsbstake-after-discount3
translatedrawgameslastdrawresultwinners3
translatedrawgameslastdrawresultwinning-stars3
sign3
drawgamesjokerpluszodiacsign3
translatedrawgameslastdrawresultwinners-in-belgium3
translatedrawgameslastdrawresultwinners-in-europe3
bull3
commonheaderpromobalance3
translatepwsregistrationpost-code3
translatedrawgameslastdrawresultgain3
index1pickvaluevaluepickvaluevaluepickvaluevalueboardstake3
mmcorelogintitle3
pwsregistrationnotsamepassword3
pwsregistrationprofessionemployee3
hhmmssmmcoreplayhistorydetailsbchannel3
mmcoreplayhistorydetailsbtotal-discount3
live3
index1pickvaluevalueboardstake3
bannertextbannershortdescription3
nodeitemname3
mmcoreloginnoaccount3
commonheadertradingbalance3

What are the nameservers for e-lotto.be?

E-lotto.be Domain Nameserver Information

HostIP AddressCountry
ns1.e-lotto.be 188.64.232.81Belgium Belgium
ns2.e-lotto.be 188.64.232.82Belgium Belgium

E-lotto.be Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if E-lotto.be is a scam?