Eastanglianancestors.co.uk Favicon Eastanglianancestors.co.uk

Eastanglianancestors.co.uk Website Thumbnail
Checking...
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
eastanglianancestors
Domain extension
co.uk
Domain registered:
08-Aug-2009
Domain updated:
10-Sep-2019
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is eastanglianancestors.co.uk ranked relative to other sites:

Percentage of visits to eastanglianancestors.co.uk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Eastanglianancestors.co.uk registered?
A: Eastanglianancestors.co.uk was registered 11 years, 2 months, 3 weeks, 10 hours, 20 minutes, 54 seconds ago on Saturday, August 8, 2009.
Q: When was the WHOIS for Eastanglianancestors.co.uk last updated?
A: The WHOIS entry was last updated 1 year, 1 month, 2 weeks, 5 days, 10 hours, 20 minutes, 54 seconds ago on Tuesday, September 10, 2019.
Q: What are Eastanglianancestors.co.uk's nameservers?
A: DNS for Eastanglianancestors.co.uk is provided by the following nameservers:
  • ns0.phase8.net
  • ns1.phase8.net
  • ns2.phase8.net
Q: Who is the registrar for the Eastanglianancestors.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Eastanglianancestors.co.uk?
A: Eastanglianancestors.co.uk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Eastanglianancestors.co.uk each day?
A: Eastanglianancestors.co.uk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Eastanglianancestors.co.uk resolve to?
A: Eastanglianancestors.co.uk resolves to the IPv4 address 85.233.160.139.
Q: In what country are Eastanglianancestors.co.uk servers located in?
A: Eastanglianancestors.co.uk has servers located in the United Kingdom.
Q: What webserver software does Eastanglianancestors.co.uk use?
A: Eastanglianancestors.co.uk is powered by webserver.
Q: Who hosts Eastanglianancestors.co.uk?
A: Eastanglianancestors.co.uk is hosted by Namesco Limited in United Kingdom.
Q: How much is Eastanglianancestors.co.uk worth?
A: Eastanglianancestors.co.uk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Eastanglianancestors.co.uk?

Eastanglianancestors.co.uk Hosting Provider Information

Hosted IP Address:85.233.160.139
Hosted Hostname:preview3.hosts.co.uk
Service Provider:Namesco Limited
Hosted Country:United KingdomGB
Location Latitude:51.4964
Location Longitude:-0.1224
Webserver Software:Not Applicable

Is "Namesco Limited" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Eastanglianancestors.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 11 Oct 2020 19:38:35 GMT
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Link:; rel="https://api.w.org/"
Content-Type: text/html; charset=UTF-8
Content-Encoding: gzip
Vary: Accept-Encoding
Age: 0
Accept-Ranges: bytes
Connection: keep-alive
Transfer-Encoding: chunked

Eastanglianancestors.co.uk Domain Nameserver Information

HostIP AddressCountry
ns0.phase8.net 81.88.63.114
ns1.phase8.net 85.233.160.68
ns2.phase8.net 91.186.2.48


Need to find out who hosts Eastanglianancestors.co.uk?


WhoIs information for Eastanglianancestors.co.uk

 Domain name:
eastanglianancestors.co.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 19-Jan-2015

Registrar:
Namesco Limited [Tag = NAMESCO]
URL: http://www.names.co.uk

Relevant dates:
Registered on: 08-Aug-2009
Expiry date: 08-Aug-2021
Last updated: 10-Sep-2019

Registration status:
Registered until expiry date.

Name servers:
ns0.phase8.net
ns1.phase8.net
ns2.phase8.net

WHOIS lookup made at 20:37:31 10-Sep-2020

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2020.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Eastanglianancestors.co.uk Free SEO Report

Website Inpage Analysis for Eastanglianancestors.co.uk

H1 Headings

1 :
  1. East Anglian Ancestors

H2 Headings

11 :
  1. Norfolk & Suffolk genealogy
  2. The Chelmondiston Haunting
  3. Brick walls – Lydia WHITTLE married to John BIRD
  4. Skulduggery in Stowmarket – Suffolk’s newest Crime Festival
  5. Crows
  6. Fressingfield Names
  7. The Fressingfield Witch
  8. Coming soon – The Fressingfield Witch
  9. Vote for Murder .99p until 20th December
  10. Overstrand in the Great War – Publish Date 9th December 2016
  11. A fatal fall – Shireoaks Colliery

H3 Headings

7 :
  1. The Ripper Deception
  2. My Sites
  3. Useful Websites
  4. Find My Past
  5. Tags
  6. Archives
  7. Affiliate Disclosure

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

19 :

Google Adsense

:
pub-5655734999796109

Google Analytics

:
Not Applicable

Links - Internal

150:
  1. Home
    http://eastanglianancestors.co.uk/
  2. Bird
    http://eastanglianancestors.co.uk/?page_id=27
  3. The Bird’s of Claydon & Kettlebaston
    http://eastanglianancestors.co.uk/?page_id=111
  4. Corben
    http://eastanglianancestors.co.uk/?page_id=35
  5. Corben’s of Devon
    http://eastanglianancestors.co.uk/?page_id=143
  6. Corben’s of The Channel Islands
    http://eastanglianancestors.co.uk/?page_id=139
  7. Dennis
    http://eastanglianancestors.co.uk/?page_id=51
  8. Fairweather
    http://eastanglianancestors.co.uk/?page_id=59
  9. Kersey
    http://eastanglianancestors.co.uk/?page_id=748
  10. Richard & Nicholas Fairweather
    http://eastanglianancestors.co.uk/?page_id=129
  11. The Children Of Richard Fairweather of Aspall
    http://eastanglianancestors.co.uk/?page_id=121
  12. Mary Cage
    http://eastanglianancestors.co.uk/?page_id=432
  13. Name Index
    http://eastanglianancestors.co.uk/?page_id=67
  14. East Anglian Ancestors
    http://eastanglianancestors.co.uk/
  15. 0 comments
    http://eastanglianancestors.co.uk/?p=859#respond
  16. The Chelmondiston Haunting
    http://eastanglianancestors.co.uk/?p=859
  17. The Ripper Deception
    http://eastanglianancestors.co.uk/?cat=233
  18. book
    http://eastanglianancestors.co.uk/?tag=book
  19. Chelmondiston
    http://eastanglianancestors.co.uk/?tag=chelmondiston
  20. Crime
    http://eastanglianancestors.co.uk/?tag=crime
  21. fiction
    http://eastanglianancestors.co.uk/?tag=fiction
  22. ghost
    http://eastanglianancestors.co.uk/?tag=ghost
  23. haunting
    http://eastanglianancestors.co.uk/?tag=haunting
  24. Jack the Ripper
    http://eastanglianancestors.co.uk/?tag=jack-the-ripper
  25. mystery
    http://eastanglianancestors.co.uk/?tag=mystery
  26. Society for Psychical Research
    http://eastanglianancestors.co.uk/?tag=society-for-psychical-research
  27. Suffolk
    http://eastanglianancestors.co.uk/?tag=suffolk
  28. Permalink
    http://eastanglianancestors.co.uk/?p=859
  29. 0 comments
    http://eastanglianancestors.co.uk/?p=837#respond
  30. Brick walls – Lydia WHITTLE married to John BIRD
    http://eastanglianancestors.co.uk/?p=837
  31. Genealogy
    http://eastanglianancestors.co.uk/?cat=25
  32. Assizes
    http://eastanglianancestors.co.uk/?tag=assizes
  33. Bird
    http://eastanglianancestors.co.uk/?tag=bird
  34. Cockfield
    http://eastanglianancestors.co.uk/?tag=cockfield
  35. Essex
    http://eastanglianancestors.co.uk/?tag=essex
  36. Hancock
    http://eastanglianancestors.co.uk/?tag=hancock
  37. Long Melford
    http://eastanglianancestors.co.uk/?tag=long-melford
  38. Maldon
    http://eastanglianancestors.co.uk/?tag=maldon
  39. Walker
    http://eastanglianancestors.co.uk/?tag=walker
  40. Whittle
    http://eastanglianancestors.co.uk/?tag=whittle
  41. Permalink
    http://eastanglianancestors.co.uk/?p=837
  42. 0 comments
    http://eastanglianancestors.co.uk/?p=822#respond
  43. Skulduggery in Stowmarket – Suffolk’s newest Crime Festival
    http://eastanglianancestors.co.uk/?p=822
  44. Uncategorized
    http://eastanglianancestors.co.uk/?cat=1
  45. Bury St Edmunds
    http://eastanglianancestors.co.uk/?tag=bury-st-edmunds
  46. Crime Fesival
    http://eastanglianancestors.co.uk/?tag=crime-fesival
  47. Fressingfield
    http://eastanglianancestors.co.uk/?tag=fressingfield
  48. genealogy
    http://eastanglianancestors.co.uk/?tag=genealogy
  49. Ipswich
    http://eastanglianancestors.co.uk/?tag=ipswich
  50. Stonham Aspal
    http://eastanglianancestors.co.uk/?tag=stonham-aspal
  51. Stowmarket
    http://eastanglianancestors.co.uk/?tag=stowmarket
  52. Suffolk library
    http://eastanglianancestors.co.uk/?tag=suffolk-library
  53. suffragette
    http://eastanglianancestors.co.uk/?tag=suffragette
  54. Witch
    http://eastanglianancestors.co.uk/?tag=witch
  55. Permalink
    http://eastanglianancestors.co.uk/?p=822
  56. 2 Comments
    http://eastanglianancestors.co.uk/?p=815#comments
  57. Crows
    http://eastanglianancestors.co.uk/?p=815
  58. No text
    http://eastanglianancestors.co.uk/wp-content/uploads/crow-2397589_1920.jpg
  59. Books
    http://eastanglianancestors.co.uk/?tag=books
  60. crows
    http://eastanglianancestors.co.uk/?tag=crows
  61. Fressingfield Witch
    http://eastanglianancestors.co.uk/?tag=fressingfield-witch
  62. superstition
    http://eastanglianancestors.co.uk/?tag=superstition
  63. Permalink
    http://eastanglianancestors.co.uk/?p=815
  64. 0 comments
    http://eastanglianancestors.co.uk/?p=805#respond
  65. Fressingfield Names
    http://eastanglianancestors.co.uk/?p=805
  66. Bury St Edmund witch trials
    http://eastanglianancestors.co.uk/?tag=bury-st-edmund-witch-trials
  67. Corbyn
    http://eastanglianancestors.co.uk/?tag=corbyn
  68. Hammond
    http://eastanglianancestors.co.uk/?tag=hammond
  69. Matthew Hopkins
    http://eastanglianancestors.co.uk/?tag=matthew-hopkins
  70. Scoggins
    http://eastanglianancestors.co.uk/?tag=scoggins
  71. Smoking baby of Fressingfield
    http://eastanglianancestors.co.uk/?tag=smoking-baby-of-fressingfield
  72. surnames
    http://eastanglianancestors.co.uk/?tag=surnames
  73. Permalink
    http://eastanglianancestors.co.uk/?p=805
  74. 0 comments
    http://eastanglianancestors.co.uk/?p=781#respond
  75. The Fressingfield Witch
    http://eastanglianancestors.co.uk/?p=781
  76. No text
    http://eastanglianancestors.co.uk/wp-content/uploads/Fressingfield-Witch-cover-small-snip.jpg
  77. Kindleunlimited
    http://eastanglianancestors.co.uk/?tag=kindleunlimited
  78. murder
    http://eastanglianancestors.co.uk/?tag=murder
  79. witchcraft
    http://eastanglianancestors.co.uk/?tag=witchcraft
  80. Permalink
    http://eastanglianancestors.co.uk/?p=781
  81. 0 comments
    http://eastanglianancestors.co.uk/?p=771#respond
  82. Coming soon – The Fressingfield Witch
    http://eastanglianancestors.co.uk/?p=771
  83. No text
    http://eastanglianancestors.co.uk/wp-content/uploads/IMG_1190.jpg
  84. No text
    http://eastanglianancestors.co.uk/wp-content/uploads/Front-Cover-snip.jpg
  85. Permalink
    http://eastanglianancestors.co.uk/?p=771
  86. 0 comments
    http://eastanglianancestors.co.uk/?p=761#respond
  87. Vote for Murder .99p until 20th December
    http://eastanglianancestors.co.uk/?p=761
  88. No text
    http://eastanglianancestors.co.uk/wp-content/uploads/Front-cover-snip.jpg
  89. ebook
    http://eastanglianancestors.co.uk/?tag=ebook
  90. kindle
    http://eastanglianancestors.co.uk/?tag=kindle
  91. Mary Cage
    http://eastanglianancestors.co.uk/?tag=mary-cage
  92. reading
    http://eastanglianancestors.co.uk/?tag=reading
  93. Stonham Aspall
    http://eastanglianancestors.co.uk/?tag=stonham-aspall
  94. Permalink
    http://eastanglianancestors.co.uk/?p=761
  95. 0 comments
    http://eastanglianancestors.co.uk/?p=751#respond
  96. Overstrand in the Great War – Publish Date 9th December 2016
    http://eastanglianancestors.co.uk/?p=751
  97. history
    http://eastanglianancestors.co.uk/?tag=history
  98. Norfolk
    http://eastanglianancestors.co.uk/?tag=norfolk
  99. Permalink
    http://eastanglianancestors.co.uk/?p=751
  100. 0 comments
    http://eastanglianancestors.co.uk/?p=728#respond
  101. A fatal fall – Shireoaks Colliery
    http://eastanglianancestors.co.uk/?p=728
  102. No text
    http://eastanglianancestors.co.uk/wp-content/uploads/Shireoaks-Colliery.jpg
  103. Charles Inman
    http://eastanglianancestors.co.uk/fam1059.html
  104. John Cuff,
    http://eastanglianancestors.co.uk/fam8433.html
  105. Charles Inman
    http://eastanglianancestors.co.uk/?tag=charles-inman
  106. John Cuffe
    http://eastanglianancestors.co.uk/?tag=john-cuffe
  107. Miner
    http://eastanglianancestors.co.uk/?tag=miner
  108. Shireoaks Colliery
    http://eastanglianancestors.co.uk/?tag=shireoaks-colliery
  109. Permalink
    http://eastanglianancestors.co.uk/?p=728
  110. ← Older posts
    http://eastanglianancestors.co.uk/?paged=2
  111. East Anglian Ancestors Main Website
    http://eastanglianancestors.co.uk/_nameindex.html
  112. Bowers
    http://eastanglianancestors.co.uk/?tag=bowers
  113. Corben
    http://eastanglianancestors.co.uk/?tag=corben
  114. Drury Lane
    http://eastanglianancestors.co.uk/?tag=drury-lane
  115. Fuller
    http://eastanglianancestors.co.uk/?tag=fuller
  116. Great Queen Street
    http://eastanglianancestors.co.uk/?tag=great-queen-street
  117. Great Waldingfield
    http://eastanglianancestors.co.uk/?tag=great-waldingfield
  118. Homerton
    http://eastanglianancestors.co.uk/?tag=homerton
  119. Laycock
    http://eastanglianancestors.co.uk/?tag=laycock
  120. Linstead
    http://eastanglianancestors.co.uk/?tag=linstead
  121. Mayflower
    http://eastanglianancestors.co.uk/?tag=mayflower
  122. Merchant Seaman
    http://eastanglianancestors.co.uk/?tag=merchant-seaman
  123. Moore
    http://eastanglianancestors.co.uk/?tag=moore
  124. New Zealand
    http://eastanglianancestors.co.uk/?tag=new-zealand
  125. Ragged School
    http://eastanglianancestors.co.uk/?tag=ragged-school
  126. Rangitata
    http://eastanglianancestors.co.uk/?tag=rangitata
  127. Redenhall
    http://eastanglianancestors.co.uk/?tag=redenhall
  128. Remeura
    http://eastanglianancestors.co.uk/?tag=remeura
  129. Roper
    http://eastanglianancestors.co.uk/?tag=roper
  130. Sea Palling
    http://eastanglianancestors.co.uk/?tag=sea-palling
  131. St Giles
    http://eastanglianancestors.co.uk/?tag=st-giles
  132. suffragist
    http://eastanglianancestors.co.uk/?tag=suffragist
  133. Vote for Murder
    http://eastanglianancestors.co.uk/?tag=vote-for-murder
  134. Waxham
    http://eastanglianancestors.co.uk/?tag=waxham
  135. world war
    http://eastanglianancestors.co.uk/?tag=world-war
  136. March 2019
    http://eastanglianancestors.co.uk/?m=201903
  137. July 2018
    http://eastanglianancestors.co.uk/?m=201807
  138. March 2018
    http://eastanglianancestors.co.uk/?m=201803
  139. November 2017
    http://eastanglianancestors.co.uk/?m=201711
  140. October 2017
    http://eastanglianancestors.co.uk/?m=201710
  141. December 2016
    http://eastanglianancestors.co.uk/?m=201612
  142. November 2016
    http://eastanglianancestors.co.uk/?m=201611
  143. November 2015
    http://eastanglianancestors.co.uk/?m=201511
  144. October 2015
    http://eastanglianancestors.co.uk/?m=201510
  145. September 2015
    http://eastanglianancestors.co.uk/?m=201509
  146. April 2015
    http://eastanglianancestors.co.uk/?m=201504
  147. April 2014
    http://eastanglianancestors.co.uk/?m=201404
  148. November 2013
    http://eastanglianancestors.co.uk/?m=201311
  149. November 2012
    http://eastanglianancestors.co.uk/?m=201211
  150. September 2012
    http://eastanglianancestors.co.uk/?m=201209

Links - Internal (nofollow)

0:

Links - Outbound

52:
  1. No text
    https://jacquelinebeardwriter.files.wordpress.com/2019/03/the-reverend-haworth-will.jpg
  2. No text
    http://mybook.to/TRD
  3. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D859&linkname=The%20Chelmondiston%20Haunting
  4. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D859&linkname=The%20Chelmondiston%20Haunting
  5. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D859&linkname=The%20Chelmondiston%20Haunting
  6. No text
    https://www.addtoany.com/share
  7. Lawrence Harpham
    http://myBook.to/TFW
  8. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D837&linkname=Brick%20walls%20%E2%80%93%20Lydia%20WHITTLE%20married%20to%20John%20BIRD
  9. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D837&linkname=Brick%20walls%20%E2%80%93%20Lydia%20WHITTLE%20married%20to%20John%20BIRD
  10. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D837&linkname=Brick%20walls%20%E2%80%93%20Lydia%20WHITTLE%20married%20to%20John%20BIRD
  11. No text
    https://www.suffolklibraries.co.uk/events/stowmarket-2018-04-28-skulduggery-jacqueline-beard/
  12. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D822&linkname=Skulduggery%20in%20Stowmarket%20%E2%80%93%20Suffolk%E2%80%99s%20newest%20Crime%20Festival
  13. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D822&linkname=Skulduggery%20in%20Stowmarket%20%E2%80%93%20Suffolk%E2%80%99s%20newest%20Crime%20Festival
  14. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D822&linkname=Skulduggery%20in%20Stowmarket%20%E2%80%93%20Suffolk%E2%80%99s%20newest%20Crime%20Festival
  15. ‘The Fressingfield Witch’
    https://www.amazon.co.uk/Fressingfield-Witch-Jacqueline-Beard-ebook/dp/B076WWY9WX/ref=pd_ecc_rvi_1
  16. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D815&linkname=Crows
  17. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D815&linkname=Crows
  18. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D815&linkname=Crows
  19. Fressingfield Witch
    https://www.amazon.co.uk/Fressingfield-Witch-Jacqueline-Beard-ebook/dp/B076WWY9WX/ref=sr_1_1?s=digital-text&ie=UTF8&qid=1509197021&sr=1-1&keywords=fressingfield
  20. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D805&linkname=Fressingfield%20Names
  21. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D805&linkname=Fressingfield%20Names
  22. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D805&linkname=Fressingfield%20Names
  23. Publishnation
    https://publishnation.co.uk/author-testimonials/
  24. Amazon Kindle Store
    https://www.amazon.co.uk/Fressingfield-Witch-Jacqueline-Beard-ebook/dp/B076WWY9WX/ref=sr_1_1?s=digital-text&ie=UTF8&qid=1509197021&sr=1-1&keywords=fressingfield
  25. Lulu Publishing
    http://www.lulu.com/shop/jacqueline-beard/the-fressingfield-witch/paperback/product-23375889.html
  26. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D781&linkname=The%20Fressingfield%20Witch
  27. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D781&linkname=The%20Fressingfield%20Witch
  28. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D781&linkname=The%20Fressingfield%20Witch
  29. news item
    http://www.foxearth.org.uk/blog/2006/01/smoking-baby-of-fressingfield-and.html
  30. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D771&linkname=Coming%20soon%20%E2%80%93%20The%20Fressingfield%20Witch
  31. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D771&linkname=Coming%20soon%20%E2%80%93%20The%20Fressingfield%20Witch
  32. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D771&linkname=Coming%20soon%20%E2%80%93%20The%20Fressingfield%20Witch
  33. http://amzn.to/2gJMfSB
    http://amzn.to/2gJMfSB
  34. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D761&linkname=Vote%20for%20Murder%20.99p%20until%2020th%20December
  35. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D761&linkname=Vote%20for%20Murder%20.99p%20until%2020th%20December
  36. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D761&linkname=Vote%20for%20Murder%20.99p%20until%2020th%20December
  37. No text
    http://www.overstrandparishcouncil.org.uk/2016/11/overstrand-in-the-great-war-book-launch/
  38. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D751&linkname=Overstrand%20in%20the%20Great%20War%20%E2%80%93%20Publish%20Date%209th%20December%202016
  39. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D751&linkname=Overstrand%20in%20the%20Great%20War%20%E2%80%93%20Publish%20Date%209th%20December%202016
  40. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D751&linkname=Overstrand%20in%20the%20Great%20War%20%E2%80%93%20Publish%20Date%209th%20December%202016
  41. Coal Mining History Resource
    http://www.cmhrc.co.uk/site/database/result/71589.html
  42. 75 fatal accidents
    http://www.healeyhero.co.uk/rescue/Fatalities/Notts/Notts-G5.html
  43. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D728&linkname=A%20fatal%20fall%20%E2%80%93%20Shireoaks%20Colliery
  44. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D728&linkname=A%20fatal%20fall%20%E2%80%93%20Shireoaks%20Colliery
  45. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D728&linkname=A%20fatal%20fall%20%E2%80%93%20Shireoaks%20Colliery
  46. No text
    https://www.amazon.co.uk/Ripper-Deception-Lawrence-Harpham-Mystery-ebook/dp/B07P9SG8RW/ref=as_li_ss_tl?crid=2XGPDZH5PXD67&keywords=the+ripper+deception&qid=1561490675&s=digital-text&sprefix=the+ripper+de,aps,134&sr=1-1&linkCode=ll1&tag=eaatrd-21&linkId=fe2ce3e6ede547028be9e20031fc0616
  47. The Fressingfield Witch
    https://www.amazon.co.uk/gp/product/B076WWY9WX/ref=as_li_ss_tl?ie=UTF8&linkCode=ll1&tag=eaatrd-21&linkId=9c7b8f5a39cecc68f89ef59f7977e128
  48. Vote For Murder
    https://www.amazon.co.uk/Vote-Murder-suffragette-murder-mystery-ebook/dp/B015N6JV1O/ref=as_li_ss_tl?ie=UTF8&linkCode=ll1&tag=eaatrd-21&linkId=6ca9a3d4616df1f9e040120e4db4ce6c
  49. The Cotswold Mortgage Broker
    http://www.cotswoldmortgagebroker.co.uk
  50. No text
    https://www.awin1.com/cread.php?s=2064801&v=2114&q=276741&r=155866
  51. WordPress
    http://wordpress.org/
  52. Elmastudio
    http://www.elmastudio.de/en/themes/

Links - Outbound (nofollow)

31:
  1. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D859&linkname=The%20Chelmondiston%20Haunting
  2. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D859&linkname=The%20Chelmondiston%20Haunting
  3. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D859&linkname=The%20Chelmondiston%20Haunting
  4. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D837&linkname=Brick%20walls%20%E2%80%93%20Lydia%20WHITTLE%20married%20to%20John%20BIRD
  5. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D837&linkname=Brick%20walls%20%E2%80%93%20Lydia%20WHITTLE%20married%20to%20John%20BIRD
  6. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D837&linkname=Brick%20walls%20%E2%80%93%20Lydia%20WHITTLE%20married%20to%20John%20BIRD
  7. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D822&linkname=Skulduggery%20in%20Stowmarket%20%E2%80%93%20Suffolk%E2%80%99s%20newest%20Crime%20Festival
  8. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D822&linkname=Skulduggery%20in%20Stowmarket%20%E2%80%93%20Suffolk%E2%80%99s%20newest%20Crime%20Festival
  9. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D822&linkname=Skulduggery%20in%20Stowmarket%20%E2%80%93%20Suffolk%E2%80%99s%20newest%20Crime%20Festival
  10. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D815&linkname=Crows
  11. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D815&linkname=Crows
  12. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D815&linkname=Crows
  13. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D805&linkname=Fressingfield%20Names
  14. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D805&linkname=Fressingfield%20Names
  15. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D805&linkname=Fressingfield%20Names
  16. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D781&linkname=The%20Fressingfield%20Witch
  17. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D781&linkname=The%20Fressingfield%20Witch
  18. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D781&linkname=The%20Fressingfield%20Witch
  19. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D771&linkname=Coming%20soon%20%E2%80%93%20The%20Fressingfield%20Witch
  20. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D771&linkname=Coming%20soon%20%E2%80%93%20The%20Fressingfield%20Witch
  21. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D771&linkname=Coming%20soon%20%E2%80%93%20The%20Fressingfield%20Witch
  22. http://amzn.to/2gJMfSB
    http://amzn.to/2gJMfSB
  23. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D761&linkname=Vote%20for%20Murder%20.99p%20until%2020th%20December
  24. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D761&linkname=Vote%20for%20Murder%20.99p%20until%2020th%20December
  25. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D761&linkname=Vote%20for%20Murder%20.99p%20until%2020th%20December
  26. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D751&linkname=Overstrand%20in%20the%20Great%20War%20%E2%80%93%20Publish%20Date%209th%20December%202016
  27. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D751&linkname=Overstrand%20in%20the%20Great%20War%20%E2%80%93%20Publish%20Date%209th%20December%202016
  28. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D751&linkname=Overstrand%20in%20the%20Great%20War%20%E2%80%93%20Publish%20Date%209th%20December%202016
  29. No text
    https://www.addtoany.com/add_to/facebook?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D728&linkname=A%20fatal%20fall%20%E2%80%93%20Shireoaks%20Colliery
  30. No text
    https://www.addtoany.com/add_to/twitter?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D728&linkname=A%20fatal%20fall%20%E2%80%93%20Shireoaks%20Colliery
  31. No text
    https://www.addtoany.com/add_to/email?linkurl=http%3A%2F%2Feastanglianancestors.co.uk%2F%3Fp%3D728&linkname=A%20fatal%20fall%20%E2%80%93%20Shireoaks%20Colliery

Keyword Cloud for Eastanglianancestors.co.uk

warbirthonehave beennewroofitsscogginsamp norwichhimmarriedyoungwhittlestorycategories uncategorized7witchcraftcategoriesmininglikejacquiseptemberbasedhe diedminerfathernorwich posttimewalkerroadcagemary cageancestorsnameamp sarahoverstrandpermalink octoberedmundsuntilfressingfieldnamedgeorgepromisingcockfieldpermalinkbeard 0 commentsst edmunds0 commentsvote for murderlawrencealllongtruecharlesifcrimemelfordamp norwich postripper deceptioncertificatekindledecemberpostownalsotaketheirinvolvedlargechildrenmaybury st3suffragettebooktherejacqui beard 0uncategorized tags booksdeceptionreverend6censuseast anglian ancestorsbooksrichardoutsocietyfairweatherpermalink novemberanywhilehauntingancestryjanehowevermaldonmurdernogenealogy tagsusedcasestonerectorytrialsfressingfield witchfoundcouldnt findmyserviceparishpsychicalstvotefamilygenealogyshireoaks collierywallsshouldwaysomestonhamothercommentssarahsetjacqui beardthomasreststillampcoalshireoaksfirstwithoutaspallbeardghostnovelreturnedlydiaaccidentdaybeard 0norwich post articlebury amplookinguphiskindleunlimitedcategories genealogy4onlythosehouseintomegoodnoiseswerehaworthoctoberrealcollierywhichworkmarriage certificate2butthingsfacthancockthroughkilledshemysterybeforesoessexcrowipswichnorfolknorwicheastfreecategories genealogy tagstags books5fallborninmaneast angliannotuncategorized tagswouldmarchpieceherdeaddidparish recordsmaryangliananglian ancestorsduringmy greatmaldon in essexrecordsnovembermarriageweekmoreveryvillagehasbury st edmundsarticlegreatdeathtags2017 by jacquicorbynanotherseveralsuffolkresearchcouldnthistory1havereadinghannahagainburylong melfordtheybury amp norwichgeorge whittlemurder mysteryafterlydia whittleleftdogeitherbelowuncategorizedbecamefindrecordsearchhadwitch trialsbeenwitchjohnpost articlednafictiondiedhecategories uncategorized tags0chelmondistonrippercrowsmannbspcharles inman

Longtail Keyword Density for Eastanglianancestors.co.uk

KeywordsOccurences
jacqui beard 09
beard 0 comments9
categories genealogy tags5
bury st edmunds5
categories uncategorized tags4
2017 by jacqui4
vote for murder4
east anglian ancestors3
bury amp norwich3
amp norwich post3
norwich post article3
maldon in essex3
uncategorized tags books3
fressingfield witch12
jacqui beard10
beard 09
0 comments9
have been7
george whittle6
shireoaks colliery6
bury st6
genealogy tags5
categories genealogy5
st edmunds5
tags books5
long melford4
uncategorized tags4
categories uncategorized4
murder mystery4
witch trials4
charles inman4
parish records4
permalink november3
anglian ancestors3
bury amp3
permalink october3
amp norwich3
norwich post3
post article3
ripper deception3
amp sarah3
he died3
lydia whittle3
my great3
marriage certificate3
couldnt find3
east anglian3
mary cage3
but30
my24
he23
fressingfield22
whittle20
witch19
george17
his16
amp16
suffolk16
have15
genealogy14
census13
they12
maldon12
one12
born11
so11
her11
up11
mary11
there11
permalink10
reverend10
tags10
categories10
murder10
been10
parish10
jacqui10
beard10
comments10
not9
found9
crime9
great9
crows9
were9
09
books9
november9
its9
st9
bury9
19
records8
married8
also8
still8
walker8
cockfield8
sarah8
find8
no8
book8
time8
some7
any7
witchcraft7
long7
crow7
colliery7
died7
death7
before6
real6
october6
only6
work6
essex6
chelmondiston6
rectory6
based6
their6
marriage6
house6
charles6
if6
lydia6
record6
me6
mystery6
shireoaks6
26
ancestors5
john5
fiction5
him5
name5
good5
more5
other5
village5
35
vote5
first5
lawrence5
jane5
ripper5
45
december5
hannah5
edmunds5
family5
another5
search5
she5
haworth5
ancestry5
named4
hancock4
through4
free4
has4
used4
trials4
novel4
stonham4
new4
melford4
either4
all4
dna4
uncategorized4
week4
after4
children4
accident4
killed4
march4
inman4
article4
young4
overstrand4
which4
involved4
road4
ipswich4
had4
54
large4
war4
64
kindle4
while4
day4
story4
those4
richard4
corbyn4
until4
kindleunlimited3
mining3
stone3
roof3
miner3
things3
suffragette3
history3
coal3
below3
dog3
scoggins3
set3
rest3
own3
fact3
reading3
fairweather3
fall3
returned3
deception3
became3
dead3
several3
left3
research3
psychical3
society3
noises3
out3
73
man3
during3
post3
norwich3
way3
haunting3
norfolk3
anglian3
east3
cage3
aspall3
ghost3
looking3
very3
birth3
should3
take3
like3
again3
couldnt3
certificate3
father3
thomas3
service3
nbsp3
walls3
true3
without3
case3
may3
however3
piece3
would3
promising3
into3
did3
september3

Eastanglianancestors.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Easta-1septic.com
easta-1septic.com
Easta-int.com
Home Page
Easta-international.com
Error 404 (Not Found)!!1
Eastaboga.org
Eastaboga
Eastabrookyoga.com
Eastabrook Yoga – Elevate Your Game
Eastacorp.com
Error 404 (Not Found)!!1
Eastactivities.com
Buy Domains - eastactivities.com is for sale!
Eastado.org
荳ュ蜿、霆雁クょ

Recently Updated Websites

Cbdcarrotcakemix.com 1 second ago.Mikroskopie-forum.de 2 seconds ago.Dakotacountrytrucks.com 3 seconds ago.Aphoticarts.com 4 seconds ago.Fondationdomus.com 4 seconds ago.G-store.ru 4 seconds ago.Vectismarine.com 4 seconds ago.Juliobenitoabogados.com 6 seconds ago.Szhlegal.com 6 seconds ago.Cryptoprime.io 6 seconds ago.Matchimpro.info 7 seconds ago.Redbankaluminum.com 7 seconds ago.Ncdreamhomes.com 7 seconds ago.Pornolarizle.com 7 seconds ago.Dozer.jp 7 seconds ago.Kimanddave.com 8 seconds ago.Urban-classics.net 8 seconds ago.Shopdutty.com 9 seconds ago.Cccsecureshare.com 10 seconds ago.Quarterbin.net 10 seconds ago.Supremerobots.com 10 seconds ago.510nora.com 10 seconds ago.Abnabat.com 11 seconds ago.Itacaitefm.com 11 seconds ago.Sgdekorasyon.com 11 seconds ago.Usbf.org 11 seconds ago.Mirro-mastic.com 12 seconds ago.Pedrocorvinosabogado.es 12 seconds ago.Aasunderland.com 13 seconds ago.Selloffgolf.org 13 seconds ago.