EC Pro Testing

Safety: Low trust score
Year Founded: 21
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Ecpro-testing.co.uk is a subdomain of Co.uk



Domain summary

Last updated
2021-10-02
Domain label
ecpro-testing
Domain extension
co.uk
Domain registered:
21-Aug-2019
Domain updated:
16-Aug-2021
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Ecpro-testing.co.uk registered?
A: Ecpro-testing.co.uk was registered 2 years, 3 months, 1 week, 2 days, 2 hours, 22 minutes, 48 seconds ago on Wednesday, August 21, 2019.
Q: When was the WHOIS for Ecpro-testing.co.uk last updated?
A: The WHOIS entry was last updated 3 months, 2 weeks, 2 hours, 22 minutes, 48 seconds ago on Monday, August 16, 2021.
Q: What are Ecpro-testing.co.uk's nameservers?
A: DNS for Ecpro-testing.co.uk is provided by the following nameservers:
  • ns1.digitalocean.com
  • ns2.digitalocean.com
  • ns3.digitalocean.com
Q: Who is the registrar for the Ecpro-testing.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Ecpro-testing.co.uk?
A: Ecpro-testing.co.uk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Ecpro-testing.co.uk each day?
A: Ecpro-testing.co.uk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Ecpro-testing.co.uk resolve to?
A: Ecpro-testing.co.uk resolves to the IPv4 address .
Q: In what country are Ecpro-testing.co.uk servers located in?
A: Ecpro-testing.co.uk has servers located in the .
Q: What webserver software does Ecpro-testing.co.uk use?
A: Ecpro-testing.co.uk is powered by Nginx/1.17.3 webserver.
Q: Who hosts Ecpro-testing.co.uk?
A: Ecpro-testing.co.uk is hosted by Unknown in .
Q: How much is Ecpro-testing.co.uk worth?
A: Ecpro-testing.co.uk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Ecpro-testing.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Ecpro-testing.co.uk Free SEO Report

Website Inpage Analysis for Ecpro-testing.co.uk

H1 Headings

1 :
  1. Tenant Account Inactive

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Ecpro-testing.co.uk

youplease

Longtail Keyword Density for Ecpro-testing.co.uk

KeywordsOccurences
you3
please3

Who hosts Ecpro-testing.co.uk?

Ecpro-testing.co.uk Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:nginx/1.17.3

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
15.7989%
GOOGLE
14.3607%
AS-26496-GO-DADDY-COM-LLC
3.8534%
NAMECHEAP-NET
3.1479%
AMAZON-AES
2.3132%
GoDaddy.com, LLC
2.0763%
UNIFIEDLAYER-AS-1
1.9874%
Fara Negar Pardaz Khuzestan
1.6407%
CONFLUENCE-NETWORK-INC
1.4732%
1&1 Internet AG
1.3797%

HTTP Header Analysis for Ecpro-testing.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
server: nginx/1.17.3
content-type: text/html; charset=UTF-8
transfer-encoding: chunked
vary: Accept-Encoding
cache-control: no-cache, private
date: Sat, 02 Oct 2021 17:31:05 GMT
x-frame-options: SAMEORIGIN
x-content-type-options: nosniff
x-xss-protection: 1; mode=block
content-encoding: gzip

Ecpro-testing.co.uk Domain Nameserver Information

HostIP AddressCountry
ns1.digitalocean.com 173.245.58.51
ns2.digitalocean.com 173.245.59.41
ns3.digitalocean.com 198.41.222.173


Need to find out who hosts Ecpro-testing.co.uk?


Domain Registration (WhoIs) information for Ecpro-testing.co.uk

 Domain name:
ecpro-testing.co.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 21-Aug-2019

Registrar:
Paragon Internet Group Ltd t/a Tsohost [Tag = UKWEBHOSTING]
URL: http://www.tsohost.co.uk

Relevant dates:
Registered on: 21-Aug-2019
Expiry date: 21-Aug-2022
Last updated: 16-Aug-2021

Registration status:
Registered until expiry date.

Name servers:
ns1.digitalocean.com
ns2.digitalocean.com
ns3.digitalocean.com

WHOIS lookup made at 18:31:06 02-Oct-2021

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2021.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Websites with Similar Names

Ecpro-testing.co.uk
EC Pro Testing
Ecpro.org
Welcome to ECPRO: Emerald Coast Public Relations Organization – Serving Okaloosa, Walton and Santa Rosa counties
Ecprocesses.com
#1 HR services in Syria,HR Consultation, Recruitment, Outsourcing in Syria
Ecproduced.com
Squarespace - Website Expired

Recently Updated Websites

Ucardeal.com (6 seconds ago.)Gazer.top (8 seconds ago.)Dodo-art.com (9 seconds ago.)Yulebet312.vip (12 seconds ago.)Highcountryskiandsports.com (12 seconds ago.)Joeltahuahua.com (15 seconds ago.)Italvideo-split.com (17 seconds ago.)Buonpastoreint.org (19 seconds ago.)Happymobi.com (22 seconds ago.)Aerolabscbd.com (22 seconds ago.)Shannonswebs.com (22 seconds ago.)381st.org (27 seconds ago.)Verdadyamor.com (29 seconds ago.)Powaynewschieftain.myclassifiedmarketplace.com (30 seconds ago.)Lemigliori-raccomandazioni-per.com (36 seconds ago.)Xahjwl.com (40 seconds ago.)Ufatop.ru (40 seconds ago.)Captcha.de (44 seconds ago.)Brittneyshepherd.com (46 seconds ago.)Monumenteyes.com (47 seconds ago.)Skyhighfitness.com (48 seconds ago.)Dontget-con.com (49 seconds ago.)Icheckdev.com (50 seconds ago.)Vueltaalostoros.fr (53 seconds ago.)Cadesmee.com (56 seconds ago.)Livelycoin.com (56 seconds ago.)Aptspecnz.com (1 minute ago.)Gettherefl.com (1 minute 2 seconds ago.)Kokbet7869.com (1 minute 5 seconds ago.)Tsunami-bike.com (1 minute 5 seconds ago.)

Recently Searched Keywords

needful meaning in hindi (2 seconds ago.)commercial pressure washing (3 seconds ago.)a life株式会社 (3 seconds ago.)looks (7 seconds ago.)live video stammtisch (8 seconds ago.)connective tissue (8 seconds ago.)boss bottled (12 seconds ago.)keuze uit (14 seconds ago.)choked (14 seconds ago.) (16 seconds ago.)bartolotti photography (16 seconds ago.)connectives (17 seconds ago.)descalade (17 seconds ago.)模具被覆机 (18 seconds ago.)table-layout (23 seconds ago.)vista rpida (24 seconds ago.)เสม็ดนางชี จุดชมวิวอ่าวพังงา (26 seconds ago.)connect 4 (28 seconds ago.)die zur (28 seconds ago.)included (29 seconds ago.)what do wealthy clients worry about (29 seconds ago.)yaşam konteyner 003 (30 seconds ago.)elementor v347 (30 seconds ago.).no-js-104286801_1_x { display: none !important (31 seconds ago.)says freedom (31 seconds ago.)vat all (32 seconds ago.)euskal (33 seconds ago.)border-radius+0 (35 seconds ago.)cupping therapy concussion (36 seconds ago.)open sans font-style (37 seconds ago.)