Edcamp.se Favicon Edcamp.se

Edcamp.se Website Thumbnail
Checking...
Captcha
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
edcamp
Domain extension
se
Domain registered:
2012-01-29
Domain updated:
2020-09-18
Domain expires:
2021-01-29
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is edcamp.se ranked relative to other sites:

Percentage of visits to edcamp.se from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Edcamp.se registered?
A: Edcamp.se was registered 8 years, 7 months, 4 weeks, 1 day, 21 hours, 13 minutes, 27 seconds ago on Sunday, January 29, 2012.
Q: When was the WHOIS for Edcamp.se last updated?
A: The WHOIS entry was last updated 1 week, 2 days, 21 hours, 13 minutes, 27 seconds ago on Friday, September 18, 2020.
Q: What are Edcamp.se's nameservers?
A: DNS for Edcamp.se is provided by the following nameservers:
  • ns1-wopsa.cygrids.net
  • ns2-wopsa.cygrids.net
Q: Who is the registrar for the Edcamp.se domain?
A: The domain has been registered at NIC-SE.
Q: What is the traffic rank for Edcamp.se?
A: Edcamp.se has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Edcamp.se each day?
A: Edcamp.se receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Edcamp.se resolve to?
A: Edcamp.se resolves to the IPv4 address 213.212.61.212.
Q: In what country are Edcamp.se servers located in?
A: Edcamp.se has servers located in the Sweden.
Q: What webserver software does Edcamp.se use?
A: Edcamp.se is powered by Imunify360-webshield/1.8 webserver.
Q: Who hosts Edcamp.se?
A: Edcamp.se is hosted by IP-Only Networks AB in Västra Götaland, Gothenburg, Sweden, 400 10.
Q: How much is Edcamp.se worth?
A: Edcamp.se has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Edcamp.se?

Edcamp.se Hosting Provider Information

Hosted IP Address:213.212.61.212
Hosted Hostname:web02-new.wopsa.se
Service Provider:IP-Only Networks AB
Hosted Country:SwedenSE
Location Latitude:57.7066
Location Longitude:11.9672
Webserver Software:imunify360-webshield/1.8

Is "IP-Only Networks AB" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Edcamp.se

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 18 Sep 2020 01:10:45 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: close
Server: imunify360-webshield/1.8
Last-Modified: Friday, 18-Sep-2020 01:10:45 GMT
Cache-Control: private, no-store, no-cache, must-revalidate, proxy-revalidate, max-age=0, s-maxage=0
Expires: Thu, 01 Jan 1970 00:00:01 GMT

Edcamp.se Domain Nameserver Information

HostIP AddressCountry
ns1-wopsa.cygrids.net 213.212.61.130
ns2-wopsa.cygrids.net 213.212.61.254


Need to find out who hosts Edcamp.se?


WhoIs information for Edcamp.se

 # Copyright (c) 1997- The Swedish Internet Foundation.
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
#
state: active
domain: edcamp.se
holder: (not shown)
admin-c: -
tech-c: -
billing-c: -
created: 2012-01-29
modified: 2019-12-19
expires: 2021-01-29
transferred: 2017-12-29
nserver: ns1-wopsa.cygrids.net
nserver: ns2-wopsa.cygrids.net
dnssec: unsigned delegation
registry-lock: unlocked
status: ok
registrar: Wopsa.se/Cygrids

Edcamp.se Free SEO Report

Website Inpage Analysis for Edcamp.se

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

1 :
  1. edcamp.se

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Edcamp.se

captchaispassedbackgroundcolorourvisiblebydefault2px0 0currentlocalenamecssreturnfunctionvalueallkeyvarrecaptchawrappervisiblecaptchaifdropdownlocationreloadtruepadding14pxelsedropdownmenucontent0color

Longtail Keyword Density for Edcamp.se

KeywordsOccurences
0 03
017
var16
dropdown13
function10
if9
captcha7
value6
else5
key5
padding5
recaptchawrapper4
our4
background-color4
visible4
14px3
currentlocalename3
2px3
return3
dropdown-menu-content3
all3
locationreloadtrue3
color3
visiblebydefault3
captchaispassed3
css3

Edcamp.se Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Edcamp.se is a scam?

Websites with Similar Names

Edcameronnbpt.com
Ed Cameron for Newburyport City Council
Edcamp.org
Edcamp |
Edcamp.se
Captcha
Edcamp217.org
edcamp217
Edcampaccessnj.org
EdcampAccessNJ
Edcamparkansas.org
Edcamp Arkansas - Home
Edcampatlanta.com
edcampatlanta.com
Edcampatx.org
Edcamp Austin
Edcampbc.org
What is Edcamp Vancouver? | Edcamp Vancouver

Recently Updated Websites

Williamhaynes.org 2 seconds ago.Corvexsafety.com 2 seconds ago.Suite100.com 4 seconds ago.Growcatnip.com 4 seconds ago.Patschmidt.us 5 seconds ago.Sleepdutchcraft.com 5 seconds ago.Meenagames.com 6 seconds ago.R84vs.lv 6 seconds ago.Jasmin-thaimassage-stuttgart.de 6 seconds ago.Armandocorrea.net 6 seconds ago.Kurmiworld.com 7 seconds ago.Naerkan.com 7 seconds ago.Jackwilsonartsite.com 7 seconds ago.Supportforamerica.com 8 seconds ago.Extensionwire.com 8 seconds ago.Merrimenthunting.com 8 seconds ago.Spellboundcollies.com 8 seconds ago.Bandasdemichoacan.com 8 seconds ago.Radioandrecordsworld.com 9 seconds ago.Kanearmy.com 9 seconds ago.Sullisports.com 10 seconds ago.Groeiparel.com 10 seconds ago.Nueva-moda.com 10 seconds ago.Inyourdreamsmovie.com 12 seconds ago.Hirecarinindia.com 12 seconds ago.Editionsaltifagiennes.com 13 seconds ago.Thebiggestsundial.com 13 seconds ago.Mayflower1620.com 13 seconds ago.Infinland.net 13 seconds ago.Easycdg.com 13 seconds ago.