IT | eD system a.s.

Safety: Low trust score
Year Founded: 2000
Global Traffic Rank: Unknown
Estimated Worth: $9

eD system a.s. - distributor hardware, software, PC komponent, mobilit a digitální techniky



Domain summary

Last updated
2021-08-27
Domain label
edcz
Domain extension
cz
Domain registered:
2000-02-17
Domain updated:
2013-01-22
Domain expires:
2023-02-16
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Edcz.cz registered?
A: Edcz.cz was registered 21 years, 7 months, 1 week, 1 day, 21 hours, 30 minutes, 8 seconds ago on Thursday, February 17, 2000.
Q: When was the WHOIS for Edcz.cz last updated?
A: The WHOIS entry was last updated 8 years, 8 months, 3 days, 21 hours, 30 minutes, 8 seconds ago on Tuesday, January 22, 2013.
Q: What are Edcz.cz's nameservers?
A: DNS for Edcz.cz is provided by the following nameservers:
  • ns.engine.cz
  • nss.engine.cz
Q: Who is the registrar for the Edcz.cz domain?
A: The domain has been registered at CZ-NIC.
Q: What is the traffic rank for Edcz.cz?
A: Edcz.cz has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Edcz.cz each day?
A: Edcz.cz receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Edcz.cz resolve to?
A: Edcz.cz resolves to the IPv4 address 195.39.32.53.
Q: In what country are Edcz.cz servers located in?
A: Edcz.cz has servers located in the Czech Republic.
Q: What webserver software does Edcz.cz use?
A: Edcz.cz is powered by Microsoft-IIS/10.0 webserver.
Q: Who hosts Edcz.cz?
A: Edcz.cz is hosted by T-Mobile Czech Republic a.s. in Hlavni Mesto Praha, Prague, Czechia, 190 00.
Q: How much is Edcz.cz worth?
A: Edcz.cz has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Edcz.cz Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Edcz.cz Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Edcz.cz

H1 Headings

0 :

H2 Headings

64 :
  1. Nejprodávanější PC a Notebooky
  2. Dell Dock WD19S 130W
  3. HP PAV Gaming 15 Backpack 400 - bag/batoh
  4. HP 15.6 SMB Backpack Case - 15,6" - BAG
  5. HP 15.6 Classic Briefcase- BAG
  6. HP Business Slim Top Load Case (up to 14.1" x .75" thick)
  7. Trust GXT 278 Notebook Cooling Stand
  8. HP 14.1 Business Sleeve Case
  9. TRUST Stojan na notebook GXT1125 QUNO LAPTOP COOLING STAND
  10. TRUST GXT 220 Kuzo Notebook Cooling Stand
  11. HP 17.3 Business Slim Top Load Case
  12. Yubico/YubiKey uutentizační multifunkční USB-A token s podporou NFC.
  13. HP 15.6 Value Top Load - BAG
  14. HP 65W USB-C LC Power Adapter
  15. TRUST Brašna na notebook 15.6" Atlanta Carry Bag ECO
  16. Toshiba/Dynabook NTB (CZ/SK) Satellite Pro C50-H-11G - 15.6" FHD,i3-1005G1,8GB,256SSD,USB-C,W10H
  17. Nejprodávanější Multifunkce a tiskárny
  18. Canon BJ CARTRIDGE PG-545XL
  19. HP 650 Black Ink Cart, 6,5 ml, CZ101AE
  20. Canon BJ CARTRIDGE CL-546XL
  21. HP 652 Black Original Ink Advantage Cartridge, , F6V25AE
  22. Canon BJ CARTRIDGE PG-540 XL BL EUR w/o SEC
  23. Canon BJ CARTRIDGE PG-545XL/CL-546XL PHOTO VALUE BL
  24. Canon BJ CARTRIDGE CL-541 XL BL EUR w/o SEC
  25. OKI Toner do B401/MB441/MB451/MB451w (2 500 stran)
  26. CANON BJ CARTRIDGE CLI-571XL C
  27. CANON BJ CARTRIDGE CLI-571XL Y
  28. Canon BJ CARTRIDGE PG-540XL/CL-541XL PHOTO VALUE BL
  29. Canon BJ CARTRIDGE PG-545/CL-546 Multi pack
  30. Canon BJ CARTRIDGE CRG CL-561XL
  31. Canon BJ CARTRIDGE PG-540 BL EUR w/o SEC
  32. Canon BJ CARTRIDGE black PG-512BK (PG512BK)
  33. Nejprodávanější Periferie
  34. SanDisk Flash Disk 16GB Ultra Flair, USB 3.0
  35. LCD HP M27f;27"; IPS matný; FHD 1920x1080; antireflexní; Led podsvícení;10M;VGA;HDMI;Flicker Free;Low Blue Light
  36. SAMSUNG MT LED LCD Monitor 27"27F396FHRXEN- prohnutý, VA, 1920x1080,4ms,60Hz,HDMI
  37. Samsung USB 3.1 Flash Disk 64GB - titan grey
  38. DELL Multimedia Keyboard-KB216 - Czech (QWERTZ) - Black
  39. Logitech MK120 CZ/SK
  40. Samsung USB 3.1 Flash Disk 64GB - silver
  41. TRUST Klávesnice GXT 860 Thura Semi-mechanical Keyboard CZ/SK
  42. SanDisk Flash Disk 16GB Cruzer Ultra Fit, USB 3.0
  43. GENIUS klávesnice s myší KM-160/ Drátový set/ USB/ černý/ CZ+SK layout
  44. ASUS myš TUF GAMING M3 (P305), černá
  45. Samsung MT LED LCD Monitor 27" 27RG50FQRXEN-prohnutý,VA,1920x1080,4ms,240Hz,HDMI,DisplayPort
  46. Samsung USB 3.1 Flash Disk 32GB - titan grey
  47. Samsung USB-C / 3.1 Flash Disk 128GB
  48. SAMSUNG MT LED LCD Monitor 27" 27F390FHRXEN - prohnutý,VA,1920x1080,4ms,60Hz,HDMI
  49. Nejprodávanější Komponenty
  50. Kingston SSD 240GB A400 SATA3 2.5 SSD (7mm height) (R 500MB/s; W 320MB/s)
  51. SSD 2,5" Samsung 870 EVO SATA III-500GB
  52. SSD 2,5" Samsung 870 EVO SATA III-1000GB
  53. CPU AMD RYZEN 5 1600 AF, 6-core, 3.2 GHz (3.6 GHz Turbo), 16MB cache, 65W, socket AM4 (Wraith cooler)
  54. SSD Samsung 980-500GB
  55. SSD 2,5" Samsung 870 EVO SATA III-250GB
  56. SSD 2,5" Samsung 870 QVO SATA III-1000GB
  57. MSI MB Sc AM4 B450 TOMAHAWK MAX II, AMD B450, 4xDDR4, 1xHDMI, 1xDVI
  58. AXAGON EE25-XA6, USB3.0 - SATA 6G, 2.5" externí ALINE box
  59. WD Elements SE Portable 1TB Ext. 2.5" USB3.0, Black
  60. PremiumCord Kabel USB 3.1 C/M - USB 2.0 A/M, rychlé nabíjení proudem 3A, 3m, bílá
  61. Cooler Master termální pasta na CPU HTK-002, tep. vodivost 0.8 W.m, 2g, bílá
  62. HITACHI LG - interní mechanika DVD-W/CD-RW/DVD±R/±RW/RAM/M-DISC GH24NSD5, 24x SATA, Black, bulk bez SW
  63. SSD 2,5" Samsung 870 QVO SATA III-2000GB
  64. PREMIUMCORD Kabel SATA 3.0 datový 50cm, kovové západky

H3 Headings

0 :

H4 Headings

5 :
  1. Konfigurátory
  2. Reklamace
  3. Služby
  4. O nás
  5. Certifikáty, soutěže a ocenění společnosti

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

139 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-64547741-5

Links - Internal

779:

Links - Internal (nofollow)

0:

Links - Outbound

22:

Links - Outbound (nofollow)

0:

Keyword Cloud for Edcz.cz

rozen zruky ksmart home externhrncetelevizenbspnbspcenukancelsk technikasporky nbspnbspusb 31pevn diskypaneluva hlopka displeje27ssd 25 samsungkategoriekartymsdtsksovmobiln telefonyporovnat ssd 25dicota productfinderstolncanon bjpodlokyproductfinderatsserial ata iiinbspnbsp dalmultifunkceramavacom bateriekonfigurtor en osrammonitortypporovnat nejprodvanjdoplkyeur wokomponentyrychlost otekvlasydostupnostvhodn nabdkanaostatn spotebnse porovnat canonproduktuvelikostnbspnbsp grafickkonfigurtorporovnat samsung usbnadic strojepdu atsdobaklvesniceczskk periferimdispleje27 rozlien19201080 fullrotanone configcoolingusbedshopu avacomsystmy nbspnbspdisplejematn formtsec tiskovskladem 99 ksweblegrand upstablety zptventiltory nbspnbspczskbl eurmdiacenu promoakce zobrazithp prod bulletinadata apc konfigurtorynbspnbsp psluenstvsekaky nbspnbspdigestoezruky kdiskgrafickproduktu spotebnho materilubarevnsamsung 870nbspnbsp psluenstv kproduktu spotebnhokapacita pevnho diskuups legrand upsmikrovlnn troubyhome externhrynabdkafunctionk servermdispleje27lenovo serversv gb1vhy nbspnbspadatawo sechpe one config31 flashdruh myioptick specifikacedope o tlopesamsung 870 evotechnologie paneluva hlopkakamery nbspnbspkflash diskna trvukabelyzpt pesystmyzubnbulletin hposramcartridgetonerpska zobrazitone config simplecbp konfigurtorhd dobanetworking hpporovnat trustlehae870 evovhyv gb1 0000elektronika zptkerpmssdtranscendchytrtechnologieinkoustov typkonfigurtory edshopu avacomprokingston baterie upskuchyntaky prozpt mobilnnbspnbsp zlohovactechnikakapacitaservers and storagesmixrykarty nbspnbspapc konfigurtory cbpms povrchovata iiikameryks pihlsit se25 samsungostatndigitlntloosram autorovkypravaautorovky hpebusinessconfig simple dicotakategorie nbspnbsp elektrickmikrovlnncookiebarhlopka displeje27spotebnho materiluernstandpoetperiferiedicotazpt mobiln telefonyvarnotebookmnbspnbsp elektrickswitchembnespecifikovnofullkalkultoryedshopu avacom bateriepodloky zobrazitselectorspecifikaceeurspeciln doplkyatributdalskladem 94ultrabookyspotebnho materilubarevnhp switch selectorspotebnho materiluern cartridgetonerpskaaudiohp 156tabulelednicegxtsamsung usb 31selector hprozenswitchapc konfigurtorykvovarytvotek vstorage lenovomateriluern cartridgetonerpska zobrazitnbspnbsp vestavnteky nbspnbsptyptaka hlopkamateriluern cartridgetonerpskase porovnat samsungcpuverze usb31lokalizacestorage lenovo serverspsluenstvchladc podlokyservery nbspnbsp870 evo satatablety mobiln telefonyrychlost otek vmonitorygb1konfigurtory edshopu000taky pro notebookystand typ psluenstvchladconeochranymobilm a tabletmmechanikyzherntrouby nbspnbspserialbaznytechnika zptbufferu vwo sec tiskovdisku v gb1selfie tyedruh myioptickpepovmbusb31 zobrazitstand typdiskussd formt25 kapacitakolekempaneluva hlopkalenovostabiliztorymateriluernzobrazit cenu promoakceblpomckykingstondisplejematnkuchyskv mbnespecifikovnoselector hp storagestoragesdruhvpromoakcesamsung usbkartky nbspnbspserverm nbspnbsp1hp networkingsmart homecooling stand typpromoakce zobrazitbaterie upstechnologie paneluvarozhranhdmitelefony a tabletytakjebatohyklvesnicepehrvampihlsittechnologieinkoustovmttyeapcotek v rpmssdrozlien19201080se porovnat nejprodvanjsedisku vled lcdfull hdpdu ats kvmpevnhodispleje156cenu zobrazit cenumykyodezvy4 msssd 25pamovks pihlsitzrukyprod bulletintablety zpt mobilnlcdhlopka displeje27 rozlien19201080velikost bufferu vproduktprakyk hudebnmiccasehp storagezdravotnickevo satareproduktorytop loadtyp diskussdspotebnhotiskrnyvysavae nbspnbspcenu dostupnost94 ks pihlsito tloconfig simpleservery a zlohovnsportporovnat samsungsetydoba odezvy4seclcd monitordesky nbspnbspipsekakytopzubn kartkygalabelbjnbspnbsp rozen zrukymateril kpsluenstv k zlohovacmdeskypamtise porovnat trusttyp psluenstvchladcsov kartyleddigestoe nbspnbspnbspnbsp runtiskovpc a notebooky99 ksswitch selectorpstroje nbspnbspstojcprvky wifihdostatn spotebn elektronikambnespecifikovno zobrazitpdupenosnvysavaebarvaern zobrazit cenubaterie ups smartkolekem zobrazit cenubj cartridgek hudebnm pehrvamvolndal kategorie nbspnbspodezvy4 ms povrchovehlikymyioptick specifikacerozen zrukymobilmprava displejematn formtdo auta nbspnbspusb 31 flashkonfigurtor hpkonfigurtorylokalizace klvesniceczskpodloky zobrazit cenupe ovelikost bufferuelementutiskov technologieinkoustov typ5lanrotan sekaky nbspnbspmt ledcenu dostupnost sklademse porovnat hp000 rozhraninternkonfigurtory cbpspotebn materil kskladem 94 ksbulletinwifiholc strojkypevnho diskutelefonyultrabookmskladem 99baterie kingstonteky kdhp storage lenovodostupnost skladem 9425 samsung 870kapacita pevnhopovrchov pravaklimatizacecbptakytechnologieinkoustov typ produktuzlohovnam4oteklegrand ups eatontekypovrchov prava displejematnk zlohovacmnbspnbsp rozendicota productfinder upsnbspnbsp parnrpmssd velikost bufferutyp diskussd formt25softwaresmartpsluenstvchladc podloky zobrazitusb31elektronikacbp konfigurtor hpups eatonpsluenstvchladcnad nbspnbspusb 30penosn audiocarepackpehrvaenejprodvanjserversk serverm nbspnbspmbnespecifikovno zobrazit cenuzahradnswitch selector hphudebnmstoragepomcky nbspnbspholcvestavndlnacenu zobrazitformt25 kapacita pevnhoksbarvaern zobrazitvaluebagadata apcoptickporovnat canonusb31 zobrazit cenuistikypevnho disku vtyp psluenstvchladc podlokyporovnat samsung mtparnstrojkytyp produktuataavacomkabelpihlsit sekapacita vformt25rotan sekakymaterilubarevns kolekemlegrand94 kspro notebookybezdrtov reproduktorytextconfiginterirovoptick mechanikyossockethp networking hpats kvmpepov ochranyexternzptsklademhrakysluchtkaelsentbtrustpsluenstv k mobilmms povrchov pravaossimple dicota productfindernbspnbsp zastihvaezobrazit cenutablety mobilnautorovky hpe onetiskov technologieinkoustovmaterilubarevn cartridgetonerpska zobrazitdal kategorieverze usb31 zobrazitspotebnmt led lcddatovcartridgetonerpskapihlsit se porovnat99 ks pihlsitkdtiskrnmrunsknmkategorie nbspnbspkabeluodezvy4canontye a stabiliztorybateriebufferuverzesamsungrozlien19201080 full hdelektricks kolekem zobrazitk pczobrazit cenu zobrazitrozhrank notebookmpromoakce zobrazit cenuvarn7porovnat hppsluenstv proproductfinder upshomeporovnat hp 156displeje27 rozlien19201080rozhranintern serialelektronick tekyfull hd dobanbspnbsp kuchyskvaendisky nbspnbspsimplevideov mbnespecifikovno zobrazitbezdrtovtop produktkartkyaudio systmyprvkyporovnatedhp prodrozhraninterndiskutyptaka hlopka displeje156diskussd formt25typtakasknserial atazlohovacmprodtyp produktu spotebnhomrazkysprchytroubyvhodnformtsec tiskov technologieinkoustovformt obrazovky169rychlostiiipsluenstv k notebookmbufferu v mbnespecifikovnodiskypokladn systmyobjhpeiii rychlostups smartevo3dpstrojepsluenstv nbspnbsppsluenstv kpaneluvakolekem zobrazitkingston baterietranscend konfigurtorlednice nbspnbspnbspnbsp psluenstv ketak sezobrazitnotebookytechnologieusb30hudebnm pehrvamtabletytabletmsocilnchhpnbspnbsp spotebndo autatelefony nbspnbspkonfigurtory cbp konfigurtorkancelskzdrojecarepack hpedshopu4usbcmultifunkce a tiskrnyloadsov prvkyhd doba odezvy4notebookautaspotebn materil31 flash diskepiltorysporkyupsata iii rychlostultrabooky nbspnbsppsluenstv keeur wo secvinotkyspecilnserveryreproduktory nbspnbspcartridgetonerpska zobrazit cenu6simple dicotasamsung mtcarepack hp networkingnetworking hp prodporovnat canon bjpceatonservermbarvaerncartridgesuikynbspnbsp doplkyhlopkabl eur womobilnk mobilmelektronickups smart homelabelspotebn elektronikapokudnbytekpevnproductfinder ups legrandmaterilkonfigurtory konfigurtory edshopunetworkingstorages en transcendteplomryssdzvlhovaematerilubarevn cartridgetonerpskazobrazit cenu dostupnostzahradn technikamyiopticknbspnbsp ostatnpsluenstvvarn deskyzdravotnick pomckypsluenstv k hudebnmblackcenu promoakcepovrchovobrazovky169spotebnho materilubarevn cartridgetonerpskagb1 000produktu spotebnho materiluernstrojevoln stojcrozhranintern serial ata000 rozhranintern serialflashkonfigurtory adataextern konfigurtoryauta nbspnbsprozlien19201080 fullkonfigurtory adata apckvmhp carepack hpplynovextern konfigurtory adatatlakomryperiferimtablety nbspnbspsataprava displejematnzpt pe odisplejematn formt obrazovky169dostupnost sklademcooling standups legrandnbspnbsp takykonfigurtor hp carepackzastihvaebulletin hp switchautorovkyse porovnatnbspnbsp spotebn materilkuchyn nbspnbspse porovnat ssdosram autorovky hpeodavovaehp switchdoba odezvy4 mshpe onemyiii rychlost oteksamsung mt ledzlohovacv rpmssd velikostavacom baterie kingstondiskussdcanon bj cartridgehlopka displeje156prod bulletin hpspotebienbspnbsp stolnzahradabaterie kingston baterieinterirov doplkynotebooky a ultrabookydostupnost skladem 992v rpmssdtiskrny nbspnbsprpmssd velikostselfieventiltoryhome extern konfigurtorywonbspnbsp dal kategorieformt25 kapacitahp carepackkonfigurtory konfigurtoryled lcd monitorhrnce nbspnbspgrily nbspnbsptrvu3porovnat ssdpokladngrilynotebookm a ultrabookmpamov karty

Longtail Keyword Density for Edcz.cz

KeywordsOccurences
ks pihlsit se60
zobrazit cenu dostupnost60
cenu dostupnost skladem60
pihlsit se porovnat60
cenu zobrazit cenu41
zobrazit cenu zobrazit41
nbspnbsp dal kategorie39
skladem 99 ks37
dostupnost skladem 9937
99 ks pihlsit37
nbspnbsp psluenstv k35
dal kategorie nbspnbsp28
zobrazit cenu promoakce16
promoakce zobrazit cenu16
cenu promoakce zobrazit16
typ produktu spotebnho15
cartridgetonerpska zobrazit cenu15
tiskov technologieinkoustov typ14
technologieinkoustov typ produktu14
canon bj cartridge12
porovnat canon bj11
se porovnat canon11
se porovnat hp10
kapacita pevnho disku9
pevnho disku v9
materilubarevn cartridgetonerpska zobrazit8
produktu spotebnho materilubarevn8
notebooky a ultrabooky8
spotebnho materilubarevn cartridgetonerpska8
rychlost otek v8
produktu spotebnho materiluern7
otek v rpmssd7
se porovnat samsung7
spotebnho materiluern cartridgetonerpska7
materiluern cartridgetonerpska zobrazit7
formt25 kapacita pevnho7
serial ata iii6
se porovnat ssd6
rozen zruky k6
mbnespecifikovno zobrazit cenu6
v mbnespecifikovno zobrazit6
bufferu v mbnespecifikovno6
velikost bufferu v6
barvaern zobrazit cenu6
telefony a tablety6
rpmssd velikost bufferu6
typ diskussd formt256
rozhranintern serial ata6
v rpmssd velikost6
iii rychlost otek6
ata iii rychlost6
diskussd formt25 kapacita6
se porovnat trust5
rozlien19201080 full hd5
pe o tlo5
porovnat ssd 255
ssd 25 samsung5
25 samsung 8705
pc a notebooky5
multifunkce a tiskrny5
k serverm nbspnbsp5
psluenstv k zlohovacm4
nbspnbsp psluenstv ke4
31 flash disk4
pdu ats kvm4
ostatn spotebn elektronika4
servery a zlohovn4
displejematn formt obrazovky1694
prava displejematn formt4
ms povrchov prava4
povrchov prava displejematn4
spotebn materil k4
nbspnbsp rozen zruky4
displeje27 rozlien19201080 full4
hlopka displeje27 rozlien192010804
full hd doba4
technologie paneluva hlopka3
bl eur wo3
eur wo sec3
hd doba odezvy43
paneluva hlopka displeje273
samsung mt led3
led lcd monitor3
mt led lcd3
wo sec tiskov3
porovnat samsung mt3
sec tiskov technologieinkoustov3
odezvy4 ms povrchov3
doba odezvy4 ms3
konfigurtor en osram3
porovnat samsung usb3
zpt mobiln telefony3
v gb1 0003
disku v gb13
870 evo sata3
samsung 870 evo3
psluenstv k notebookm3
notebookm a ultrabookm3
taky pro notebooky3
nbspnbsp spotebn materil3
tablety zpt mobiln3
tablety mobiln telefony3
samsung usb 313
tye a stabiliztory3
psluenstv k mobilm3
mobilm a tabletm3
psluenstv k hudebnm3
k hudebnm pehrvam3
kolekem zobrazit cenu3
s kolekem zobrazit3
druh myioptick specifikace3
usb31 zobrazit cenu3
usb 31 flash3
verze usb31 zobrazit3
konfigurtory konfigurtory edshopu3
osram autorovky hpe3
storages en transcend3
networking hp prod3
hp prod bulletin3
prod bulletin hp3
bulletin hp switch3
hp switch selector3
switch selector hp3
selector hp storage3
hp storage lenovo3
storage lenovo servers3
servers and storages3
zpt pe o3
rotan sekaky nbspnbsp3
carepack hp networking3
do auta nbspnbsp3
kategorie nbspnbsp elektrick3
legrand ups eaton3
ups legrand ups3
productfinder ups legrand3
dicota productfinder ups3
simple dicota productfinder3
config simple dicota3
one config simple3
hpe one config3
autorovky hpe one3
hp networking hp3
hp carepack hp3
konfigurtory edshopu avacom3
dostupnost skladem 943
edshopu avacom baterie3
avacom baterie kingston3
baterie kingston baterie3
kingston baterie ups3
baterie ups smart3
ups smart home3
smart home extern3
home extern konfigurtory3
se porovnat nejprodvanj3
94 ks pihlsit3
skladem 94 ks3
extern konfigurtory adata3
konfigurtor hp carepack3
konfigurtory adata apc3
adata apc konfigurtory3
apc konfigurtory cbp3
konfigurtory cbp konfigurtor3
podloky zobrazit cenu3
psluenstvchladc podloky zobrazit3
typ psluenstvchladc podloky3
stand typ psluenstvchladc3
cooling stand typ3
cbp konfigurtor hp3
typtaka hlopka displeje1563
porovnat hp 1563
000 rozhranintern serial3
zobrazit cenu120
ks pihlsit60
dostupnost skladem60
se porovnat60
pihlsit se60
cenu dostupnost60
psluenstv k53
nbspnbsp psluenstv42
cenu zobrazit41
dal kategorie39
nbspnbsp dal39
skladem 9937
99 ks37
kategorie nbspnbsp28
promoakce zobrazit16
cenu promoakce16
produktu spotebnho15
cartridgetonerpska zobrazit15
typ produktu15
tiskov technologieinkoustov14
technologieinkoustov typ14
bj cartridge12
canon bj12
porovnat canon11
nbspnbsp ostatn11
k serverm10
porovnat hp10
pe o10
kapacita pevnho9
pevnho disku9
mobiln telefony9
disku v9
otek v8
nbspnbsp elektrick8
rozen zruky8
rychlost otek8
spotebnho materilubarevn8
typ diskussd8
materilubarevn cartridgetonerpska8
v rpmssd7
formt25 kapacita7
spotebnho materiluern7
materiluern cartridgetonerpska7
porovnat samsung7
psluenstv ke7
karty nbspnbsp6
iii rychlost6
barvaern zobrazit6
rpmssd velikost6
zruky k6
velikost bufferu6
bufferu v6
v mbnespecifikovno6
mbnespecifikovno zobrazit6
porovnat ssd6
spotebn materil6
ata iii6
flash disk6
vysavae nbspnbsp6
serial ata6
rozhranintern serial6
diskussd formt256
spotebn elektronika6
kapacita v6
nbspnbsp vestavn6
pevn disky6
samsung 8705
25 samsung5
ssd 255
desky nbspnbsp5
digestoe nbspnbsp5
nad nbspnbsp5
psluenstv nbspnbsp5
serverm nbspnbsp5
typtaka hlopka5
porovnat trust5
rozlien19201080 full5
full hd5
o tlo5
technika zpt5
nbspnbsp doplky4
varn desky4
mikrovlnn trouby4
lednice nbspnbsp4
hrnce nbspnbsp4
sekaky nbspnbsp4
ultrabooky nbspnbsp4
holc strojky4
vhodn nabdka4
top produkt4
hlopka displeje1564
hlopka displeje274
displeje27 rozlien192010804
hd doba4
ms povrchov4
povrchov prava4
prava displejematn4
displejematn formt4
formt obrazovky1694
usb 314
31 flash4
zubn kartky4
tak se4
ats kvm4
nbspnbsp rozen4
pokladn systmy4
teky kd4
k zlohovacm4
sov karty4
kancelsk technika4
ostatn spotebn4
pdu ats4
kamery nbspnbsp4
k periferim4
materil k4
sov prvky4
k pc4
teky nbspnbsp3
k hudebnm3
k mobilm3
nbspnbsp zlohovac3
k notebookm3
usb 303
elektronika zpt3
sec tiskov3
wo sec3
eur wo3
bl eur3
audio systmy3
systmy nbspnbsp3
penosn audio3
pamov karty3
hudebnm pehrvam3
telefony nbspnbsp3
bezdrtov reproduktory3
pepov ochrany3
870 evo3
nbspnbsp stoln3
servery nbspnbsp3
evo sata3
porovnat nejprodvanj3
94 ks3
skladem 943
v gb13
gb1 0003
000 rozhranintern3
selfie tye3
tablety mobiln3
elektronick teky3
verze usb313
tiskrny nbspnbsp3
nbspnbsp spotebn3
pro notebooky3
nbspnbsp grafick3
tablety nbspnbsp3
reproduktory nbspnbsp3
kolekem zobrazit3
s kolekem3
myioptick specifikace3
druh myioptick3
lokalizace klvesniceczsk3
usb31 zobrazit3
disky nbspnbsp3
zpt mobiln3
taky pro3
samsung usb3
odezvy4 ms3
doba odezvy43
paneluva hlopka3
technologie paneluva3
lcd monitor3
nbspnbsp taky3
mt led3
samsung mt3
psluenstv pro3
optick mechaniky3
tablety zpt3
led lcd3
config simple3
prvky wi-fi3
sporky nbspnbsp3
transcend konfigurtor3
lenovo servers3
storage lenovo3
hp storage3
voln stojc3
selector hp3
switch selector3
do auta3
hp switch3
pstroje nbspnbsp3
bulletin hp3
na trvu3
rotan sekaky3
prod bulletin3
auta nbspnbsp3
osram autorovky3
interirov doplky3
hpe one3
dicota productfinder3
productfinder ups3
ups legrand3
legrand ups3
ups eaton3
one config3
kartky nbspnbsp3
ic stroje3
nbspnbsp kuchysk3
vhy nbspnbsp3
grily nbspnbsp3
kuchyn nbspnbsp3
autorovky hpe3
nbspnbsp parn3
ventiltory nbspnbsp3
zahradn technika3
hp prod3
simple dicota3
konfigurtory edshopu3
kingston baterie3
baterie kingston3
hp 1563
avacom baterie3
edshopu avacom3
top load3
cooling stand3
ups smart3
stand typ3
typ psluenstvchladc3
psluenstvchladc podloky3
podloky zobrazit3
konfigurtory konfigurtory3
nbspnbsp run3
baterie ups3
smart home3
networking hp3
hp carepack3
hp networking3
nbspnbsp zastihvae3
zpt pe3
zdravotnick pomcky3
pomcky nbspnbsp3
carepack hp3
speciln doplky3
home extern3
konfigurtor hp3
cbp konfigurtor3
konfigurtory cbp3
apc konfigurtory3
adata apc3
konfigurtory adata3
extern konfigurtory3
trouby nbspnbsp3
nbspnbsp416
zobrazit121
cenu120
zpt87
psluenstv73
k71
se70
dostupnost60
ks60
pihlsit60
porovnat60
skladem60
dal40
kategorie39
037
typ35
v31
hp26
pro20
tiskov19
promoakce18
usb17
kapacita16
elektrick15
produktu15
spotebnho15
na15
cartridgetonerpska15
konfigurtory14
technologieinkoustov14
ostatn14
tiskrny13
karty13
o13
hlopka13
notebooky13
samsung13
s13
cartridge13
technika12
canon12
spotebn12
elektronika12
servery12
bj12
telefony11
doplky11
vysavae11
galabel11
tablety11
pc11
cookie-bar11
serverm10
pe10
ups9
pevnho9
disku9
sata9
systmy9
teky9
mobiln9
sov8
rozen8
zruky8
kabel8
pokud8
ke8
zahradn8
digestoe8
pokladn8
velikost8
klvesnice8
materilubarevn8
ultrabooky8
do8
otek8
optick8
desky8
ssd8
18
disky8
flash8
trouby8
rychlost8
diskussd8
audio8
multifunkce7
lednice7
bl7
je7
materiluern7
verze7
vestavn7
formt257
tak7
top7
grafick7
rpmssd7
praky6
ehliky6
hrnce6
grily6
vhy6
mbnespecifikovno6
sporky6
sekaky6
nbytek6
obj6
black6
bufferu6
iii6
ata6
serial6
barvaern6
26
rozhranintern6
druh6
disk6
spotebie6
else6
kancelsk6
kd6
baterie6
wi-fi6
prvky6
materil6
datov6
pevn6
kamery6
my6
mdia6
zlohovac6
konfigurtor6
zahrada5
ventiltory5
podloky5
35
periferie5
45
reproduktory5
mrazky5
rozhranhdmi5
voln5
specifikace5
pomcky5
sport5
zastihvae5
tlo5
nad5
typtaka5
extern5
elektronick5
technologie5
hd5
hern5
rozlien192010805
zdroje5
zubn5
full5
kartky5
trust5
mechaniky5
komponenty5
cpu4
os4
produkt4
zlohovacm4
nabdka4
vhodn4
displeje274
software4
tlakomry4
pamti4
ram4
holc4
epiltory4
skn4
sknm4
teplomry4
strojky4
stoln4
nejprodvanj4
notebook4
displeje1564
bag4
case4
doba4
led4
ms4
povrchov4
lcd4
zlohovn4
usb304
prava4
displejematn4
formt4
obrazovky1694
value4
54
czsk4
switche4
ed4
lan4
0004
smart4
stroje4
home4
odavovae4
monitory4
ip4
periferim4
suiky4
3d4
chytr4
web4
digitln4
am44
televize4
tiskrnm4
var4
taky4
autorovky4
z4
storage4
text4
kingston4
mixry4
dtsk4
vinotky4
hraky4
bazny4
sprchy4
pdu4
batohy4
tv4
myky4
ats4
kvm4
lokalizace4
varn4
mikrovlnn4
run4
atribut3
klvesniceczsk3
elementu3
ultrabookm3
notebookm3
label3
odezvy43
eur3
wo3
sec3
rozhran3
ntb3
function3
socilnch3
kabelu3
kolekem3
mb3
paneluva3
socket3
monitor3
gb13
evo3
myioptick3
sety3
mt3
usb313
prod3
kabely3
adata3
vaen3
kuchysk3
cbp3
apc3
kuchyn3
kvovary3
lehae3
networking3
parn3
istiky3
zvlhovae3
klimatizace3
ic3
auta3
carepack3
video3
edshopu3
osram3
switch3
selector3
lenovo3
servers3
storages3
transcend3
hpe3
pehrvae3
one3
config3
simple3
dicota3
productfinder3
legrand3
eaton3
avacom3
stojc3
selfie3
poet3
gxt3
cooling3
stand3
psluenstvchladc3
usb-c3
63
penosn3
business3
hry3
tabletm3
mobilm3
stabiliztory3
73
tye3
load3
hudebnm3
plynov3
zdravotnick3
dlna3
pstroje3
trvu3
rotan3
interirov3
vlasy3
speciln3
pehrvam3
tabule3
ochrany3
pepov3
kalkultory3
sluchtka3
bulletin3
pamov3
bezdrtov3

Who hosts Edcz.cz?

Edcz.cz Hosting Provider Information

Hosted IP Address:195.39.32.53
Hosted Hostname:195.39.32.53
Service Provider:T-Mobile Czech Republic a.s.
Hosted Country:Czech RepublicCZ
Location Latitude:50.1202
Location Longitude:14.4976
Webserver Software:Microsoft-IIS/10.0

Is "T-Mobile Czech Republic a.s." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
T-Mobile Czech Republic a.s.
0.0348%

HTTP Header Analysis for Edcz.cz

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Vary: Accept-Encoding
Server: Microsoft-IIS/10.0
X-AspNet-Version: 4.0.30319
Request-Context: appId=cid-v1:c26b151d-e982-4d37-b315-316e3f6adb3c
X-Powered-By: ASP.NET
X-UA-Compatible: IE=edge
Date: Fri, 27 Aug 2021 06:00:47 GMT

Edcz.cz Domain Nameserver Information

HostIP AddressCountry
ns.engine.cz 90.181.224.13Czech Republic Czech Republic
nss.engine.cz 195.39.32.12Czech Republic Czech Republic


Need to find out who hosts Edcz.cz?


Domain Registration (WhoIs) information for Edcz.cz

 % (c) 2006-2021 CZ.NIC, z.s.p.o.
%
% Intended use of supplied data and information
%
% Data contained in the domain name register, as well as information
% supplied through public information services of CZ.NIC association,
% are appointed only for purposes connected with Internet network
% administration and operation, or for the purpose of legal or other
% similar proceedings, in process as regards a matter connected
% particularly with holding and using a concrete domain name.
%
% Full text available at:
% http://www.nic.cz/page/306/intended-use-of-supplied-data-and-information/
%
% See also a search service at http://www.nic.cz/whois/
%
%
% Whoisd Server Version: 3.12.2
% Timestamp: Fri Aug 27 06:00:54 2021

domain: edcz.cz
registrant: SB:ELINKX-AS-CZ
admin-c: RV17-EL
nsset: NSS:ELINKX-AS-CZ:1
registrar: REG-INTERNET-CZ
registered: 17.02.2000 12:51:00
changed: 22.01.2013 17:21:59
expire: 16.02.2023

contact: SB:ELINKX-AS-CZ
org: ELINKX a.s.
name: ELINKX a.s.
address: Novoveska 95
address: Ostrava-Mar. Hory
address: 70900
address: CZ
registrar: REG-INTERNET-CZ
created: 10.08.2001 22:13:00
changed: 15.05.2018 21:32:00

contact: RV17-EL
name: Rostislav Vocilka
address: Novoveska 95
address: Ostrava
address: 70900
address: CZ
registrar: REG-CZNIC
created: 10.08.2001 22:13:00
changed: 15.05.2018 21:32:00

nsset: NSS:ELINKX-AS-CZ:1
nserver: ns.engine.cz
nserver: nss.engine.cz
nserver: ns5.hsx.cz (185.58.41.63)
tech-c: LK17-EL
tech-c: SB:ELINKX-AS-CZ
registrar: REG-INTERNET-CZ
created: 01.10.2007 02:00:00
changed: 15.01.2020 14:52:00

contact: LK17-EL
name: Lumir Kunath
address: Novoveska 95
address: Ostrava
address: 70900
address: CZ
registrar: REG-CZNIC
created: 10.08.2001 22:13:00
changed: 15.05.2018 21:32:00

Websites with Similar Names

Edcz.cz
IT | eD system a.s.
Edcz.ru
403 Forbidden
Edczoo.com
Cheap Domain Names-Domain Name Registration-Transfer-Renewal: NameSilo

Recently Updated Websites

Jxj.rocks (16 seconds ago.)Cdyihang.com (16 seconds ago.)Ragsdalelab.com (17 seconds ago.)Noahfunkhouser.com (17 seconds ago.)Yayubet1437.vip (23 seconds ago.)Thedouglasgrove.com (25 seconds ago.)Goldenmattresses.com (28 seconds ago.)Reconstitutionhistorique.com (30 seconds ago.)Sweetstreetcandyshop.com (30 seconds ago.)Becpropertymaintenance.com (31 seconds ago.)Eeeeis.icu (32 seconds ago.)Yayubet2478.vip (34 seconds ago.)Escolaspeniche.com (36 seconds ago.)Kirmizicantaliavukat.net (39 seconds ago.)Barakahventures.us (39 seconds ago.)Bocktingpianos.nl (39 seconds ago.)Thisisnotferrari.com (43 seconds ago.)Iberetvous.com (44 seconds ago.)Nowrongclothing.com (51 seconds ago.)Fastpctools.com (51 seconds ago.)Sevenhillspsych.com (53 seconds ago.)Etfloors.com (53 seconds ago.)Guillehosting.online (54 seconds ago.)Fzqyd.com (57 seconds ago.)Cl9g.com (58 seconds ago.)Readyforead.com (59 seconds ago.)Gazeta670.com.br (1 minute 3 seconds ago.)Queen-of-ruin.com (1 minute 4 seconds ago.)Thebotailor.com (1 minute 5 seconds ago.)Storeofdaydreams.com (1 minute 8 seconds ago.)

Recently Searched Keywords

stark customs (1 second ago.)обрезка (2 seconds ago.)özel yunus emre hastanesi (2 seconds ago.)name category (3 seconds ago.)winwidth 980 var (3 seconds ago.)ceny ju od (4 seconds ago.)亚洲完美的奶油蛋糕结局 (4 seconds ago.)raftech motorsport (5 seconds ago.)widget myrepublic slider (5 seconds ago.)147 important (6 seconds ago.)bold italic localmontserrat-bolditalic (6 seconds ago.)einen kommentar zu (6 seconds ago.)neomed (7 seconds ago.)water bookish bespectacled (7 seconds ago.)rgs (7 seconds ago.)dyrk1b (8 seconds ago.)documentgetelementbyidmoaronclick function var (8 seconds ago.)panerai submersible (9 seconds ago.)xng khi (9 seconds ago.)toshoshitsu no kanojo: seiso na kimi ga ochiru made the animation (10 seconds ago.)lens gaming glasses (11 seconds ago.)itinerario de trenes (11 seconds ago.)media max-width767px sppb-addon-1557355293185 (12 seconds ago.)healthcare names (13 seconds ago.)x close (14 seconds ago.)вебинар «секс» [инна литвиненко] (14 seconds ago.)boliviano bosnia-herzegovina convertible (15 seconds ago.)ethisifvttypeisobjectethrow (16 seconds ago.)iyi bir (16 seconds ago.)athletics meaning (17 seconds ago.)