|  Pferde kaufen und Pferde verkaufen | Pferdemarkt
Low trust score  | 
Pferde kaufen und Pferde verkaufen ✔ Über 17.000 Pferde-Inserate ✔ Täglich mehr als 300 neue Pferde ✔ Europas führender Pferdemarkt Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:G
Alexa Rank Alexa Rank:108,621
Majestic Rank Majestic Rank:664,645
Domain Authority Domain Authority:52%
DMOZ DMOZ Listing:No

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
% Restricted rights.
% Terms and Conditions of Use
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:

Status: connect
Changed: 2017-05-04T09:12:24+02:00

Name: Jens Urban
Organisation: ehorses Gmbh & Co. KG
Address: Rittergut Osthoff 5
PostalCode: 49124
City: Georgsmarienhuette
CountryCode: DE
Phone: +4954018813206
Fax: +4954018813210
Email: Login to show email

Name: Jens Urban
Organisation: ehorses Gmbh & Co. KG
Address: Rittergut Osthoff 5
PostalCode: 49124
City: Georgsmarienhuette
CountryCode: DE
Phone: +4954018813206
Fax: +4954018813210
Email: Login to show email

Who hosts is hosted by Hetzner Online GmbH in Germany. has an IP Address of and a hostname of and runs nginx/1.8.1 web server. Web Server Information

Hosted IP Address:
Service Provider:Hetzner Online GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:nginx/1.8.1

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache, no-store, must-revalidate
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/8.5
X-AspNetMvc-Version: 4.0
X-AspNet-Version: 4.0.30319
Access-Control-Allow-Origin: *
Date: Mon, 29 Jun 2015 07:54:35 GMT
Content-Length: 35088

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

altwrttembergergibt esmfertig sfertig2tippsrottalerpopularittder verschiedenenoder auchauch deranderereine vielzahlda sieaber auchauf denextremhannoveranertemperamentuntersuchungbestehtmeistpferderaquopreisnatrlichsich daswirsolltenbeliebtheitblocker undefinedsuchtpferdemarkt bietetaddie in ihrersindauf ehorsespferd mitknnendes pferdesjetztjesozialverhaltenverkauftwerpferde nachbis zumdtopsellerunterschiedlichezahlreicheinteressenteninseratlplatziert mplatziert splatziertvielzahlstockma vonpony bis zumzudem6keinevom pony bismehr alsdanebeneignungendennpersnlichenpferde verkaufenadsbelgischeshengstesowie dasaufgrund dervieledeutscheoder alsdaangebotnach einemzu findensowiedarber hinausmchtenvom ponywarmblternponyrassenprofessionellenpassendeneingesetztbei denlfertigkutschauch imzumtop1offsetregionverschiedenenwerdenvor demeinem geeignetenzu vergesseneplatziert aplatziertkaltkaltblterist estrue elsepferdekaufpferdensollhingegen berdas englischeden reiterxe05dpferdeartenihrergeltenpferde kaufenaber auch dasbezeichnungwurdezur auswahldenwelcheihrenkinderlfertig mfertig sfertigoldenburgerbermit blickdiesemblick aufeinem stockmaimmereplatziertobhobbyreitenmehrerenschafftnoteuropauerstkostenlosinteressenten frreitpferd11verschiedenen pferderassenverkaufspferdenaplatziert lplatziertumpferderasse dergruppeeigenschafteninseratedurchvor allem diehohender suchestutenbereichamschwerenfr kutschfahrtenwar0turniersporterhhteprobereitenpferddarbersie sichreitenauswahlad blocker undefinedes einwennauch frhinhervorragendweitstehenreitponyfohlenziehen vonzwischen demdie eineinkreuzungab 0ein pferdweiseallermitzurdieszuchtbestenshire horsesich auchdass sicheinigekaltblutkufer dieeine erhhteweltweitponys diesich das pferdactivated ad blockergrtenihres gewichtsallesweltweit verbreitetkuferehorses berwhrendim zuge derquarter horsezeigensowohlgroblocker undefined truebestand gefhrdetneuunteroder beiraquonbspmehreventnorikerihrer abstammung aufholsteinerlast12springreitenelse ifaraberdressur und springreitenlfertig mfertignot activenochgroenvon bis zuzu klrenhingegenkrftigen21wer sichdass4damitcodeutschesauf der sucheaplatziert lplatziert mplatziertauch vonbestandausgerichtetbeider weltseitanfrage quartermchteempfiehlt esmplatziert splatziertlassenmit einem stockmaenglische vollblutblick auf dengezchtetausreichendmeterbei derohnescrolltopbverwendungkannals arbeitspferdeineshaflingerbesondersmillionenkamenkommenabstammungkrpergewichtzum ziehen vonactivateddas pferdeinige pferderassenalle wichtigenpony bishengstgewichtsihnenbeim pferdekauftraberdaruntertypeofdas passende30 jahrekutschpferdfr das pferdvon 148das deutscheseit demwie8sollen24gropferdeempfiehlt es sichpferde sindist hingegenberblickdie mglichkeitpony freherdie sichlediglichtipps frfr denstetsnacheinerzeitactivebeimsollteandereein pferd zusich hingegendermeistenpferderassenpferdehaltungsportpferdheutemitbringenfunctionverkaufspferdeaufgrundgrtezum ziehenauf diewindowfbqgibtanbietenmfertignewnbspeinsatzmehrinsbesondere dassichpasoerfolgegalopprennsportfindenihrer abstammung19 jahrhundertdurchausweltdas englische vollblutsondernifwelchemhinsichtlichprsentierenihrvon pferdenauch diefinden siead blockerber diepferdetypendeckhengsteschwarzwlderdlmenerif typeofstalldie zu dentrue else ifwirdder pferdemarktim zugezu empfehlenrassefalseabvortraumpferdseiteknnen sie3ihre17typvielfach18blockerhabenden warmblternklrenwarmblutaplatziertbezeichnetauch einhufigkleinstedisttop1schleswigerdemzentimeternebensooderanzeigenhierbeidie einkreuzunglassen sichgeeignetengropferdim brigenausdauerauf dasactivated adfakeselectlplatziertohren13empfehlenseinkopfvollerreichenvarpferdetypesishidden1hatsich kuferbieteteineschonwichtigenzuchtgebietlplatziert mplatziertelsesich mithandeltsplatziertpferderassehunterschnelltop3offsetwarmblterdie bersich durchslidesperviewzuchtstutenvoltigierenfr ihredocumentreadyfunctionauchpferdesportvergessenkutschfahrtenauf anfragehinausteilwesterndurch dievielseitigeninformationenonlineblickkaufenraquonbspmehr infosrassenmit einemverbreitungeigneneinem stockma vonnicht zuletztmachenelse if typeofeinen berblickseinerzurckgehendeszugkaltblut frreitpartnertrakehnerdressurschlielichgre22durch einediesezuge dershireblick auf diemecklenburgerempfiehltehorsespferde diewerden pferdeponyvomzusammenumfasstvon 148 zentimeternals topselleram bestenauf demanfragebeliebigals besondersgeschlechtihresreitbeteiligungzweiten1das kaltblut10einem geeigneten pferdsennerfr daspferdemarktpferdeverkaufandalusier9stockmahilfestockma von 148undefinedder pferdeverkaufverkaufendeutlichkaumkufer fr5horse fakeselectseisportpferdeob ponysfertigjahre15zwischenauf anfrage quarterinfosdie meistensuche nachgeeigneten pferdlaufenfr kuferalsopferd zuneuewarenjetzt inserierendurch die einkreuzungsucheauch dasfreizeitpassendeinsbesonderebrigen148 zentimeternzunchstdas westernreitenusageeignetedie zukmverfgeneuropasmerkmalekeinreitihremdiebeziehungsweiseeinundefined true elsebeispielsweisemglichkeitabersind dieactive addabeijahrenehorses pferdemarktplattformvon bisdas hobbyreitendisttop3englischeishidden3suche nach einemauf derafertigdass sierundsogarje nach23flltziehenfalabellatragenhingegen dasponysdie pferdehaltungihr pferdsoihrem bestand gefhrdetsind aberzum einsatzbisoder einverschiedenedeutschlandhorsesfrwichtigdie verbreitungdasquartereinenandereninternationalenzuschnelligkeitein ponybis zuhohebekannteinmalausbildungsstandbei der suchepferderasse der weltpferdesportsselbstwesternreitenpony oderunsafertig lfertigoftmalssehrausgebildetunseremsuchenalle19gehaltenber einekaufen mchtenvon derdiesendisziplinenshetlandvoll und kaltblutso sindspringpferdwiedermit pferdenb bzhlenerfolge eplatziert aplatziertnur nocheinen neuenwurdensetzenimauerdemaller rassennurafertig lfertig mfertigentwickeltkrperbauvollblut7durch dasallembesitzerdaherif disttop3jedochschwervielseitigkeitrolledementsprechenderfolge eplatzierteplatziert aplatziert lplatziertpferde allerrund umdass pferdeeignungwildmenschenmit blick aufdannsei esmglichim bereichmerkmalenmplatziertgefhrdetistgiltobjtextentsprechendundefined truearbeitspferdalteres sichpferderassen dienicht nurefertig20zahlreichenhorsebedrohtum diepassende pferdkilogrammreitersievor allemdisziplinkommtschweresgeeignetreitpferdeleistungsfhigkeitnicht zu vergessenjahrhundertmglichstweiterevollblterverbreitetist dasactive ad blockerder pferdekaufeingesetzt werdenangebotensich pferdetagearabischenishidden3 ifvollblutaraberfr dievielenzu denzumalallem diezum grtenganzfindet16als auchabstammung auftrueeinemnot active adder suche nachsvonsondern auchnmlichausverkuferpferdesder pferdelanderscheinunginserierenoder warmblutzuletzteinteilenneuenamericannicht zu14anfrage quarter horseihrem bestandpferderassen frzugenichtdes pferdesportsmannach einem geeignetensich einealsauf

Longtail Keyword Density for

true else if7
einem stockma von6
mit einem stockma6
mit blick auf6
else if typeof5
von bis zu5
vor allem die4
ihrem bestand gefhrdet4
dressur- und springreiten4
blocker undefined true4
ad blocker undefined4
pferderasse der welt4
der suche nach4
nicht zu vergessen4
anfrage quarter horse4
suche nach einem4
auf anfrage quarter4
blick auf den3
bei der suche3
blick auf die3
l-platziert m-platziert s-platziert3
die zu den3
a-platziert l-platziert m-platziert3
aber auch das3
empfiehlt es sich3
undefined true else3
not active ad3
active ad blocker3
a-fertig l-fertig m-fertig3
l-fertig m-fertig s-fertig3
activated ad blocker3
erfolge e-platziert a-platziert3
e-platziert a-platziert l-platziert3
ihrer abstammung auf3
sich das pferd3
nach einem geeigneten3
im zuge der3
einem geeigneten pferd3
pony bis zum3
ein pferd zu3
vom pony bis3
zum ziehen von3
fr das pferd3
die in ihrer3
auf der suche3
durch die einkreuzung3
voll- und kaltblut3
stockma von 1483
von 148 zentimetern3
das englische vollblut3
fr den18
vor allem18
quarter horse16
das pferd16
fr das14
bis zum13
mit einem12
aber auch12
auch das9
bis zu9
auf der9
blick auf9
als auch9
stockma von9
ber die8
ein pferd8
der pferdemarkt8
nicht nur8
bei der8
auf den8
ihr pferd8
des pferdes8
jetzt inserieren8
fr die8
zu den8
auf dem8
true else7
b b7
der suche7
pferderassen die7
auf die7
nach einem7
else if7
sich das6
einem stockma6
bei den6
pferde kaufen6
mit blick6
es sich6
am besten6
ad blocker6
if typeof6
ist es6
rund um6
durch die6
zum einsatz6
da sie5
von bis5
oder auch5
knnen sie5
sondern auch5
lassen sich5
pferd zu5
sowie das5
auf anfrage5
sind die5
die sich5
mehr als5
der pferde5
eingesetzt werden5
pferderasse der5
von der5
suche nach5
vor dem5
auf das5
darber hinaus5
die mglichkeit5
raquonbspmehr infos5
im zuge5
auch fr5
gibt es5
vom pony4
durch eine4
hingegen ber4
nicht zuletzt4
148 zentimetern4
bestand gefhrdet4
ihrem bestand4
der welt4
beim pferdekauf4
undefined true4
blocker undefined4
von pferden4
zu vergessen4
auch der4
dass sich4
nur noch4
ziehen von4
nicht zu4
oder ein4
zu klren4
allem die4
sei es4
pony fr4
horse fakeselect4
aller rassen4
zu finden4
anfrage quarter4
shire horse4
auch im4
einen neuen4
durch das3
aufgrund der3
das deutsche3
ponys die3
e-platziert a-platziert3
sich durch3
fr kufer3
den reiter3
als arbeitspferd3
erfolge e-platziert3
die zu3
einige pferderassen3
sie sich3
a-platziert l-platziert3
l-platziert m-platziert3
die einkreuzung3
not active3
die ber3
30 jahre3
von 1483
active ad3
tipps fr3
ihrer abstammung3
englische vollblut3
oder warmblut3
das englische3
m-platziert s-platziert3
abstammung auf3
den warmbltern3
activated ad3
kaltblut fr3
ishidden3 if3
sich mit3
ist das3
l-fertig m-fertig3
a-fertig l-fertig3
das passende3
passende pferd3
pferd mit3
zu empfehlen3
empfiehlt es3
sich kufer3
der pferdekauf3
sich eine3
der verschiedenen3
if disttop33
als besonders3
m-fertig s-fertig3
verschiedenen pferderassen3
wer sich3
einen berblick3
auch die3
die pferdehaltung3
das westernreiten3
ihres gewichts3
kufer die3
fr kutschfahrten3
pferderassen fr3
alle wichtigen3
eine vielzahl3
eine erhhte3
der pferdeverkauf3
pferdemarkt bietet3
pferde nach3
ob pony3
kaufen mchten3
als topseller3
kufer fr3
ehorses pferdemarkt3
hingegen das3
interessenten fr3
um die3
oder bei3
auch von3
pony oder3
sich pferde3
ist hingegen3
das hobbyreiten3
die verbreitung3
pferde die3
insbesondere das3
pony bis3
so sind3
des pferdesports3
pferde sind3
sich hingegen3
oder als3
19 jahrhundert3
im bereich3
dass pferde3
sich auch3
zum ziehen3
seit dem3
ein pony3
ehorses ber3
die ein3
fr ihre3
auf ehorses3
dass sie3
weltweit verbreitet3
einem geeigneten3
werden pferde3
geeigneten pferd3
mit pferden3
zum grten3
pferde verkaufen3
die meisten3
im brigen3
pferde aller3
je nach3
zur auswahl3
zuge der3
auch ein3
ber eine3
das kaltblut3
sind aber3
finden sie3
zwischen dem3
es ein3
ab 0-3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Germany Germany Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?