Eirene.org  |  Eirene | Internationaler Christlicher Friedensdienst
Low trust score  | 

Eirene.org Website Information

Eirene.org has a Low Trust Score, a Statvoo Rank of I, an Alexa Rank of 6,301,931, a Majestic Rank of 973,200, a Domain Authority of 44% and is not listed in DMOZ.

Eirene.org is hosted by domainfactory GmbH in Germany.
Eirene.org has an IP Address of 93.187.237.237 and a hostname of 93.187.237.237 and runs Apache/2.4.10 web server.

The domain eirene.org was registered 201 decades 8 years 9 months ago by , it was last modified 201 decades 8 years 9 months ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for eirene.org

Full Whois Lookup for Eirene.org Whois Lookup

Domain Name: EIRENE.ORG
Registry Domain ID: D4180682-LROR
Registrar WHOIS Server:
Registrar URL: http://www.registrygate.com
Updated Date: 2017-04-20T01:21:06Z
Creation Date: 1997-04-18T04:00:00Z
Registry Expiry Date: 2018-04-19T04:00:00Z
Registrar Registration Expiration Date:
Registrar: RegistryGate GmbH
Registrar IANA ID: 1328
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C122003828-LROR
Registrant Name: Thorsten Klein
Registrant Organization: EIRENE-Int. Christl. Friedensdienst e.V.
Registrant Street: Engerser Str. 81
Registrant City: Neuwied
Registrant State/Province:
Registrant Postal Code: 56564
Registrant Country: DE
Registrant Phone: +49.263183790
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C122003828-LROR
Admin Name: Thorsten Klein
Admin Organization: EIRENE-Int. Christl. Friedensdienst e.V.
Admin Street: Engerser Str. 81
Admin City: Neuwied
Admin State/Province:
Admin Postal Code: 56564
Admin Country: DE
Admin Phone: +49.263183790
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C115443510-LROR
Tech Name: Jan Diegelmann
Tech Organization: [email protected] Internet Informationssysteme GmbH
Tech Street: Wandalenweg 5
Tech City: Hamburg
Tech State/Province:
Tech Postal Code: 20097
Tech Country: DE
Tech Phone: +49.402388090
Tech Phone Ext:
Tech Fax: +49.4023880929
Tech Fax Ext:
Tech Email: Login to show email
Server: NS.WORK.DE
Name Server: HULK.WORK.DE
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-09-13T02:52:56Z

Who hosts Eirene.org?

Eirene.org Web Server Information

Hosted IP Address:93.187.237.237
Hosted Hostname:93.187.237.237
Service Provider:domainfactory GmbH
Hosted Country:GermanyDE
Location Latitude:51
Location Longitude:9
Webserver Software:Apache/2.4.10

HTTP Header Analysis for Eirene.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 24 Dec 2015 06:00:54 GMT
Server: Apache/2.4.10
X-Powered-By: PHP/5.2.17
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Cache-Control: store, no-cache, must-revalidate, post-check=0, pre-check=0
Last-Modified: Thu, 24 Dec 2015 06:00:54 GMT
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8


Need to find out who hosts Eirene.org?

Eirene.org Free SEO Report

Website Inpage Analysis for Eirene.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Eirene.org

soaktuellewurdediestaatensichtransparenzdieseanvertrautenpaxeirene internationaler christlicherjederkinder und jugendlicheberichtenfruns anvertrauten spendenspenden und ffentlichenlesenunsnbspmeldungnbsp eireneneuwiedden eirenespiritusajahrewir die unsunsere einnahmen kamenwarmanuns ein wichtigeskinderdeszuschsse verwendetlesen sie imfr diekrisenprventioneinmarokkoneben dem rckblickdavidsie imden friedenplattforminternationaldazu0die weltplattform zivilewiefinanzberichtber unsere arbeitwichtiges anliegen nebeninformiert sie berprojekte und aktivittensie beranliegen neben demwichtiges anliegendennim tschadhier diejahresberichtfriedensdienst eireneunter anderemdassuns eindeutschlanderstellungnahmedie erstenanvertrauten spendenistim finanzberichtfrankreichzuschsse verwendet habenspendenverwendetinformierthabeeirenerundbriefberfr den friedenallegewaltfreiegibtwerdenbildfoto von hannesnachzivilenfreiwilligenrundbriefkamen und wofrzurmitchristlicher friedensdienstneuenchristlicherihreeinnahmen kamenlassenmenschen ausdownloadfr michfreiwilligendienstezfdweiterkongober diebundesregierungeinemit denverwendet habenunterist einauslandsteudtnerinternationaler christlicherinternationaleunsere arbeit imfriedensdienst in deutschlandim finanzbericht woherarbeit imrckblickwoher unsereneben demder weltzivilerder jahresberichthornebergegenbeimzeitffentlichen zuschsse verwendetvorhaben weiternimmtplatzaufgenommenbeibisplattform zivile konfliktbearbeitungmachtaprilknnen sienicaraguaim letzten jahraktivitten lesen sieaus demhaben weiter lesenlesen nbspmeldungnbsp eirenedenn transparenzerstezuhierorganisationenzuschssesieaus ugandahabenjahrendeminternationaler christlicher friedensdiensthatder draktivitten lesenspakamenauf dember unsereumoderdjeralarfreiwilligendienstwofr wir diefriedensdienstpeterfotoquotdasdiesem rundbriefbremenfriedensarbeitist uns einhannes horneberugandawelthans koschnickeireneim letztenarbeitwelchedeutschentschadffentlichen zuschssehansder dr kongoverschiedenen2konfliktbearbeitungauf unsere projektealsbosnienherzegowinaknnendurchwofrmenschenderauskeinedem rckblick aufrckblick aufanliegenanderenmalein wichtigesweiter lesenlndernaufinternationalenvon david kubowskyplatz 33findenbspmeldungnbsp eirene rundbriefwirwir diegemeinsamewofr wirfordertgewalt60 jahreweiter lesen nbspmeldungnbsplernerfahrungeninternationalen freiwilligenuns anvertrautenvonzivilesindlesen sieder plattform zivileichmussnbspmit demessenwirdfr eineinfoseminareder plattformkubowskybei eirenedenn transparenz istunsere arbeitmicheirenespiritdeutscheeirene internationalervon hannesweilfoto vonfr denneueeinenlesebuchrckblick auf unseredrinsgesamtvon daviddiesemtransparenz istlesen nbspmeldungnbspfinanzbericht woherhanduganda nicaraguaim auslandvon hannes hornebernbspmeldungnbspzivile konfliktbearbeitungsommerffentlichentransparenz ist unsverwendet haben weiterersten5ihrist unseineseinemnichtseitdenprojektemilitrischenhannesjahr denn transparenzist frist esganzwoher unsere einnahmenpartnerorganisationenzivilgesellschaftaberanliegen nebenletzten jahrdie uns anvertrautenrumnienburundidie unsunseregewaltfrei frinformiert siefotos4kannimsowieeinerzwischenseminarsie im finanzberichtfrauensie ber unsereein wichtiges anliegenvon eirenemit eireneden usaunsere einnahmeneinfachamwichtigesdasaktivittenzumfriedensfrderungdenensofiadieserkeineirene rundbrieffoto von davidauf unsereder bundesregierungpax christiarbeit im letztenpeter steudtnerfinanzbericht woher unsereletztendr kongoletzten jahr dennjahrfreiwilligeforderngewaltfreiesnebenjahr denndavid kubowskyinternationalerkoschnickanderemauchjulieinnahmenunsere projekte1jahresbericht 2016wohergemeinsamimmerzivilen friedensdienstchristidem rckblickjugendlichefrieden

Longtail Keyword Density for Eirene.org

KeywordsOccurences
weiter lesen nbspmeldungnbsp36
nbspmeldungnbsp eirene rundbrief9
lesen nbspmeldungnbsp eirene9
finanzbericht woher unsere4
woher unsere einnahmen4
unsere einnahmen kamen4
im finanzbericht woher4
internationaler christlicher friedensdienst4
projekte und aktivitten4
kamen und wofr4
lesen sie im4
sie im finanzbericht4
die uns anvertrauten4
zuschsse verwendet haben4
haben weiter lesen4
fr den frieden4
ffentlichen zuschsse verwendet4
spenden und ffentlichen4
wir die uns4
auf unsere projekte4
uns anvertrauten spenden4
wofr wir die4
aktivitten lesen sie4
im letzten jahr4
letzten jahr denn4
jahr denn transparenz4
arbeit im letzten4
rckblick auf unsere4
informiert sie ber4
sie ber unsere4
ber unsere arbeit4
denn transparenz ist4
unsere arbeit im4
anliegen neben dem4
dem rckblick auf4
transparenz ist uns4
wichtiges anliegen neben4
neben dem rckblick4
ist uns ein4
ein wichtiges anliegen4
uns ein wichtiges4
foto von david3
von david kubowsky3
foto von hannes3
kinder und jugendliche3
von hannes horneber3
der dr kongo3
verwendet haben weiter3
eirene internationaler christlicher3
der plattform zivile3
plattform zivile konfliktbearbeitung3
friedensdienst in deutschland3
lesen nbspmeldungnbsp36
weiter lesen36
foto von17
nbspmeldungnbsp eirene11
eirene rundbrief9
bei eirene8
jahresbericht 20166
zivile konfliktbearbeitung6
fr den6
uns ein6
aus dem6
sie im5
wir die5
fr eine5
fr die5
dr kongo5
internationalen freiwilligen5
unsere einnahmen4
anvertrauten spenden4
ffentlichen zuschsse4
uns anvertrauten4
die uns4
wofr wir4
zuschsse verwendet4
einnahmen kamen4
fr mich4
haben weiter4
woher unsere4
mit den4
hans koschnick4
die welt4
diesem rundbrief4
ber die4
der bundesregierung4
auf dem4
den frieden4
internationaler christlicher4
verwendet haben4
ber unsere4
christlicher friedensdienst4
sie ber4
arbeit im4
ist uns4
denn transparenz4
jahr denn4
finanzbericht woher4
im letzten4
letzten jahr4
unsere arbeit4
ein wichtiges4
transparenz ist4
auf unsere4
rckblick auf4
unsere projekte4
aktivitten lesen4
im finanzbericht4
lesen sie4
informiert sie4
dem rckblick4
wichtiges anliegen4
neben dem4
anliegen neben4
ist es3
im tschad3
menschen aus3
mit eirene3
pax christi3
platz 33
david kubowsky3
von hannes3
hannes horneber3
der welt3
von david3
aus uganda3
60 jahre3
ist fr3
den eirene-spirit3
der dr3
mit dem3
im ausland3
unter anderem3
uganda nicaragua3
eirene internationaler3
peter steudtner3
gewaltfrei fr3
von eirene3
den usa3
knnen sie3
friedensdienst eirene3
hier die3
zivilen friedensdienst3
plattform zivile3
der plattform3
die ersten3
ist ein3
der jahresbericht3
die91
der88
eirene53
von52
fr49
lesen42
nbspmeldungnbsp41
weiter36
im35
mit35
den32
das31
ist30
foto28
sie28
auf26
aus23
dem22
wir21
des21
zu21
friedensdienst17
unsere17
ein17
ber16
uns16
bei16
eine15
rundbrief13
es13
am13
sich13
eirene-spirit12
war12
so12
haben12
werden12
deutschland11
zivile11
hat11
sind11
welt11
einer10
jahresbericht10
zum10
auch10
arbeit10
konfliktbearbeitung9
einen9
ich9
nicaragua9
jahr9
gemeinsam9
frieden8
freiwilligen8
zur8
einem8
man8
alle8
hier8
wurde8
nicht8
aber7
sowie7
menschen7
dass7
dr7
freiwillige7
spenden7
freiwilligendienst7
internationalen6
internationaler6
bosnien-herzegowina6
jahre6
zivilen6
projekte6
neuwied6
diesem6
kongo6
wie6
06
um6
wird6
denn6
knnen5
spa5
frankreich5
essen5
unter5
neuen5
ihre5
jugendliche5
deutsche5
kinder5
nach5
immer5
vor5
uganda5
mich5
platz5
als5
frauen5
er5
kamen5
april5
fotos5
nbsp5
informiert5
ganz5
krisenprvention4
lndern4
lassen4
diese4
erste4
tschad4
ersten4
bild4
14
jeder4
kann4
militrischen4
zwischenseminar4
welche4
macht4
anderen4
einfach4
koschnick4
dazu4
hans4
bundesregierung4
partnerorganisationen4
seit4
ffentlichen4
wofr4
einnahmen4
woher4
zuschsse4
verwendet4
juli4
steudtner4
peter4
fordert4
finanzbericht4
aktivitten4
usa4
rumnien4
24
christlicher4
letzten4
transparenz4
rckblick4
neben4
anliegen4
wichtiges4
ausland4
anvertrauten4
ihr4
34
eirene-rundbrief4
burundi3
gewalt3
aufgenommen3
gegen3
aktuelle3
mal3
neue3
fordern3
organisationen3
keine3
staaten3
download3
oder3
friedensarbeit3
43
internationale3
denen3
ziviler3
hand3
hannes3
habe3
horneber3
finde3
infoseminare3
53
kubowsky3
david3
lernerfahrungen3
quotdas3
weil3
marokko3
friedensfrderung3
dieser3
gewaltfrei3
gibt3
kein3
bremen3
bis3
verschiedenen3
gewaltfreie3
stellungnahme3
nimmt3
zfd3
sommer3
deutschen3
plattform3
jahren3
muss3
insgesamt3
beim3
sofia3
anderem3
djeralar3
eines3
durch3
lesebuch3
international3
gemeinsame3
zeit3
berichten3
freiwilligendienste3
christi3
pax3
zivilgesellschaft3

What are the nameservers for eirene.org?

Eirene.org Domain Nameserver Information

HostIP AddressCountry
ns.work.de 212.12.32.174Germany Germany
hulk.work.de 213.178.67.30Germany Germany

Eirene.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Eirene.org is a scam?