Elektrostandard.net Website Analysis Summary

Elektrostandard.net  |  ??????? ????? - Elektrostandard ??????????? ????. ?????? ? ??????????? ? ??????.
Low trust score  | 
????????????? ???????????? ? ?????? | ??????, ???????????, ?????, ??? ? ??. ??????? ????? - Elektrostandard


Rank
100,088
Rating
F
Trust Score
Low Trust Score
Estimated worth
$125,400
Estimated daily income
$209
Estimated monthly income
$6,357
Backlinks
0

Elektrostandard.net has a Low Trust Score, and a Statvoo Rank of F.

Elektrostandard.net is hosted by Beget Ltd in Russia.
Elektrostandard.net has an IP Address of 5.101.152.66 and a hostname of m2.serena4.beget.ru and runs nginx/1.9.2 web server.

The domain elektrostandard.net was registered 4 years 11 months 2 weeks ago by REGIONAL NETWORK INFORMATION CENTER, JSC DBA RU-CENTER, it was last modified 4 years 10 months 3 weeks ago and currently is set to expire 3 years 11 months 1 week ago.

It is the world's 100,088 most popular site among over 300 million websites.

Elektrostandard.net has a total of 0 backlinks.

Elektrostandard.net gets approximately 12,417 unique visitors a day and 83,525 pageviews per day.

Elektrostandard.net has an estimated worth of $125,400.
An average daily income of approximately $209, which is wroughly $6,357 per month.

Whois information for elektrostandard.net

Full Whois Lookup for Elektrostandard.net Whois Lookup

Domain Name: ELEKTROSTANDARD.NET
Registry Domain ID: 1901853516_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.nic.ru
Registrar URL: http://nic.ru
Updated Date: 2017-02-03T08:08:11Z
Creation Date: 2015-02-10T10:09:13Z
Registry Expiry Date: 2018-02-10T10:09:13Z
Registrar: Regional Network Information Center, JSC dba RU-CENTER
Registrar IANA ID: 463
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +7 (495) 994-46-01
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.BEGET.RU
Name Server: NS2.BEGET.RU
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-09-04T15:58:57Z

Who hosts Elektrostandard.net?

Elektrostandard.net Web Server Information

Hosted IP Address:5.101.152.66
Hosted Hostname:m2.serena4.beget.ru
Service Provider:Beget Ltd
Hosted Country:RussiaRU
Location Latitude:55.7386
Location Longitude:37.6068
Webserver Software:nginx/1.9.2

HTTP Header Analysis for Elektrostandard.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.9.2
Date: Sat, 11 Jul 2015 00:42:29 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=30
X-Powered-By: PHP/5.5.26
P3P: policyref="/bitrix/p3p.xml", CP="NON DSP COR CUR ADM DEV PSA PSD OUR UNR BUS UNI COM NAV INT DEM STA"
X-Powered-CMS: Bitrix Site Manager (043e3a8d6c771c7a5381cf15254ce68d)
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Encoding: gzip

Need to find out who hosts Elektrostandard.net?

Elektrostandard.net Free SEO Report

Website Inpage Analysis for Elektrostandard.net

H1 Headings:1
0
H2 Headings:1
32
H3 Headings:1
16
H4 Headings:1
4
H5 Headings:1
1
H6 Headings:1
0
Total IFRAMEs:0
Total Images:30
Google Adsense:Not Applicable
Google Analytics:UA-63921845-1

Keyword Cloud for Elektrostandard.net

ifwindowarsetparamshasownpropertyobj2936383nbspstarover mydivclassname staractivei mydivthissetcontentresult setwindow bxvisualidnbsp nbsp nbspwindowarsetparams ifwindowarsetparamshasownpropertyobj forvarwndsize bxgetwindowinnersize setwindownanothermalifbxvisualid infodocumentgetelementbyiddiscvoter1i ifmydiv ifflaghtml4setwindowoffsetheight2 setwindowstyleleft wndsizeinnerwidthparentidsetwindowstyletop popuptop 0documentgetelementbyidnewvoter1i ifmydiv ifflagwndsizeinnerheight setwindowoffsetheight2 setwindowstyleleftvar obresult documentcreateelementdivopacity 100 draggabledsk80 5wwhilemydiv documentgetelementbyidhitvoter1i ifmydivsavedclassnameadditemincartaddednull autohideifmydivclassnamestaractive starover mydivclassnamewhilemydiv0 popuptop pxifclose 0mydiv documentgetelementbyiddiscvoter1i ifmydivquantity60 3bxmessagetitlebar contentparentidinnerhtml bxmessagejscoreloading bxparentidinnerhtmlpopuptop 0qntitemslength i qntitemsivaluewndsizeinnerwidth setwindowoffsetwidth2 pxpopupwindowbtnclose popupwindowbtnorder sitedirmydiv documentgetelementbyidnewvoter1i ifmydivstarover elseparentidinnerhtml bxmessagejscoreloadingwindowarsetparamsobjobj2 bxpropssetpopuptop px 0thissetcontentresultarparamsvote ydocumentgetelementbyidparentid ifobcontainer varsitedirqntitemsbxfindchildrenbxvisualid classnametrue bxaddclassbxvisualidvotevalue bxajaxpostifmydiv ifflagobcontainer bxwait parentidinnerhtmlbxvisualid ifsetwindow popuptopbxaddclassbxvisualid popupwindowarsetparamsobjbxpopupwindowmanagercreatevisualid0 qntitemslengthvar cursetparamswndsizeinnerwidth setwindowoffsetwidth2ifwindowarsetparams forvarcursetparams windowarsetparamsobjobj2windowarsetparamsstarover else ifmydivsavedclassnamer21 whilemydiv documentgetelementbyidhitvoter1imydivsavedclassname mydivclassnamer dividmatchnewvotedd varhandler 0false closeicon rightarparams handlerbxvisualidpopupwindowtitleqntitems bxfindchildrenbxvisualid classnamebxaddclassbxvisualid offerslist closestaroverpopupwindowbtnordercursetparams bxdelegatefunctionresult varcdw fobj2popuptop wndscrollscrolltopbxaddclassbxvisualid popup moreoptionsbxcreatespan html contenttitlebar content bxcreatespanbxwaitcontent events onafterpopupshowr21 whilemydiv documentgetelementbyidnewvoter1iautohide true offsetleftforieastecclassname popupwindowcloseicon true75handler vardocumentgetelementbyiddiscvoter1i ifmydivsavedclassname mydivclassnameclosebyesc falseobj in windowarsetparamsvar wndscroll bxgetwindowscrollposvar rwndsizeinnerheightr2 function handlerdatadividmatchnewvotedd100 draggablesetwindowstyleleft wndsizeinnerwidth setwindowoffsetwidth2else ifmydivsavedclassnameifobcontainer var obresultalfaopacity 100setwindowoffsetheight2ifmydivsavedclassname mydivclassnamearparams cursetparams bxdelegatefunctionresultofferslist offerslist falsemoreoptions ifofferslist truefunction handlerdatawndscrollbogatesbxgetwindowinnersize setwindow popuptopifmydivclassnamestaractivetitlebarlightwhilemydiv documentgetelementbyidhitvoter1idocumentgetelementbyiddiscvoter1itrue bxaddclassbxvisualid offerslisthandlerdataarparamsvoteid voteidvotevalueifqntitemsbxgetwindowscrollpos wndsize0 closelength foridocumentgetelementbyidnewvoter1i ifmydivsavedclassname mydivclassname10px topifobj2 visualid varquantity true ifqntitemsobcontainerparentnodereplacechildobresultfirstchild obcontainerfalse ifwindowarsetparams forvarbxajaxpost bitrixcomponentsbitrixiblockvotecomponentphp arparamsvoteid r1 varpx 0var obresultpopuptop wndscrollscrolltop wndsizeinnerheightclose bxfindchildrenbxvisualidofferslist close2eurosvet 2936383bxparentidinnerhtmlvar obcontaineri mydiv documentgetelementbyidnewvoter1iquantity truecloselengthnblmydivsavedclassname i r21true offsetleft 0ifsetwindowfunction handlerdata vardocumentgetelementbyidhitvoter1i ifmydivsavedclassname mydivclassnamecontent eventspopup moreoptionssetwindowpopup null arparamselementidvalueqntitemslengthcloseiconright 10px topmoreoptionsr dividmatchnewvoteddbxpropssetpopup bxpopupwindowmanagercreatevisualid nullmydivsavedclassnamefalse closebyescbxaddclassbxvisualidobcontainerparentnodereplacechildobresultfirstchildadditemincartadded popupwindowtitlevar r dividmatchdiscvoteddmydivsavedclassname mydivclassname ifmydivclassnamestaractiveelse qntitems bxfindchildrenbxvisualidarparamscursetparamshtml contentclassnamesetwindowstyletop popuptopmydivclassname mydivsavedclassname mydivclassnamedovote functiondivclassname popupwindowcloseiconfunction ifbxvisualidbxmessagejscoreloading arparamsvote y0 1mydivclassnameobcontainerbxfindchildrenbxvisualid classname popupwindowcloseiconpopupwindowcloseiconifmydivsavedclassnameifobcontainer varmydivclassname ifmydivclassnamestaractivemydiv documentgetelementbyidhitvoter1i ifmydivwhilemydiv documentgetelementbyidnewvoter1i ifmydivsavedclassnamewindowarsetparamsobj ifwindowarsetparamsobjhasownpropertyobj2 ifobj2dividmatchnewvotedd varsetwindow popuptop thissetcontentresultpopuptop thissetcontentresultoffsettop 0arparams bxpropssetpopup bxpopupwindowmanagercreatevisualidmydivclassname ifmydivclassnamestaractive starover3ifqntitems 05w 3300kifflagelementidvalue bxaddclassbxvisualid popup5w 4200kobresultifclosewndscrollscrolltop wndsizeinnerheight setwindowoffsetheight2parentid arparams varwndsizeinnerheight setwindowoffsetheight2bxpopupwindowmanagercreatevisualid nullvoteidonafterpopupshow function ifbxvisualidvotevalue r2 functiondss001autohidefalsearparamsvotedata obcontainerparentnodereplacechildobresultfirstchildclosebyesc false closeiconvar wndscrollright 10pxarparamsvoteiddocumentgetelementbyidhitvoter1i ifmydivwndscroll bxgetwindowscrollpos wndsizemydivsavedclassname i dovoteelektrostandard dskr81arparams bxpropssetpopupifwindowarsetparamshasownpropertyobj forvar obj2documentgetelementbyidnewvoter1i ifmydivsavedclassnamecloselength forifalse closebyesc falseelementidifmydiv ifflag ifmydivsavedclass011ifflag ifmydivsavedclassobcontainer documentgetelementbyidparentid ifobcontainerfcloseiinnerhtml bxpropssetpopupshownewpopupwindowtitle popupwindowbtncloseclosebyescpopupifwindowarsetparamsobjhasownpropertyobj2events onafterpopupshow functiononafterpopupshow functionvisualid var cursetparamsmydivsavedclassname mydivclassname mydivsavedclassnamedskr81 5warparamsratingluminexvar obcontainer documentgetelementbyidparentidwindowarsetparamsobjobj2elektrostandard elektrostandardclosepopupwindowbtnclosecdw f 5w10px top 10pxdocumentcreateelementdivunitssetwindowstyleleft wndsizeinnerwidthifmydivsavedclassname mydivclassname mydivsavedclassnamesetwindow popuptopofferslist offerslist offerslistdatabxpropsset popupr21 whilemydivhandlerdata var obcontainerelse ifmydivsavedclassname mydivclassname220 800 offsettop 0draggable falsewndsize bxgetwindowinnersize10px titlebarclassname quantitylussoleofferslist offersliststarover mydivclassnamecloseicon rightvar voteid r1r21 whilemydiv documentgetelementbyiddiscvoter1itrue ifclosesetwindow bxvisualid ifsetwindowarparams handler varpopupwindowtitle popupwindowbtnclose popupwindowbtnorderpopupwindowbtnorder sitedirdovotevoteid arparamsrating votevaluebxgetwindowscrollposelementid offerslist offerslistbxmessagejscoreloading bxparentidinnerhtml bxmessagejscoreloadingdocumentgetelementbyidparentidfunctiontrue ifclose 04200kihandlerdsk80setwindowoffsetwidth2 pxpx setwindowstyletopvisualid varywndsizedocumentgetelementbyidnewvoter1ibitrixcomponentsbitrixiblockvotecomponentphp arparamsy arparamsvoteidvar r dividmatchnewvoteddobresult documentcreateelementdiv obresultinnerhtmlbxgetwindowinnersizebitrixcomponentsbitrixiblockvotecomponentphpobcontainerparentnodereplacechildobresultfirstchild obcontainer bxwaitwindowarsetparams ifwindowarsetparamshasownpropertyobjofferslistpopup nulldraggable false closebyesc10pxoffsettop 0 overlayifmydivsavedclass mydivsavedclassname mydivclassnamecloselength fori 0popupwindowcloseicon truey arparamsvoteid voteidvarbxgetwindowscrollpos wndsize bxgetwindowinnersizepopuptop thissetcontentresult setwindowbxmessagejscoreloading arparamsvoteifsetwindow popuptopcursetparams bxdelegatefunctionresultf 5wqntitemsivaluecontent bxcreatespandocumentgetelementbyiddiscvoter1i ifmydivsavedclassnamesetwindowoffsetwidth2eurosvetbxmessagejscoreloading bxparentidinnerhtml9ifmydivsavedclass mydivsavedclassnameobresult documentcreateelementdivelektrostandardparentidinnerhtmlpopupwindowbtnclose popupwindowbtnorder0 qntitemslength forir dividmatchhitvotedd vareventselektrostandard dskr81 5wtrue ifqntitemsautohide truefalse closeiconvar votevalue r2ifqntitems 0 qntitemslengthdata obcontainerparentnodereplacechildobresultfirstchild obcontainervar cursetparams windowarsetparamsobjobj20 popuptopbxpropsset popup nullfunctiondiv parentidbxdelegatefunctionresult10var votevaluebxdelegatefunctionresult var wndscrollifwindowarsetparamsevents onafterpopupshowelementid offerslistmydivoverlay opacityvotevalue r218html content eventswhilemydiv documentgetelementbyiddiscvoter1iarparamsrating votevalue bxajaxpostbxmessage additemincartaddedr1wndsizeinnerwidthcloseiinnerhtmlbxmessagejscoreloadingodeon lightbxparentidinnerhtml bxmessagejscoreloading arparamsvotefunctiondiv parentid arparamsbitrixcomponentsbitrixiblockvotecomponentphp arparams handlerclose bxfindchildrenbxvisualid classnameclassname quantity truevoteid r1true offsetleftobji mydiv documentgetelementbyiddiscvoter1ioffsetleftsetwindow bxvisualidr2bxgetwindowinnersize setwindowr1 varhandlerdata varcontent bxcreatespan html0 i mydivbxparentidinnerhtml bxmessagejscoreloadingdividmatchdiscvotedd var voteidcdwwhilemydiv documentgetelementbyidnewvoter1idskr81popuptop pxnull arparams bxpropssetpopupinfo bxajaxpoststaractive staroveradditemincartadded popupwindowtitle popupwindowbtncloseobj2 in windowarsetparamsobj0 overlay opacityoverlay opacity 100opacitybxmessage additemincartadded popupwindowtitlemydivclassname staractiveobcontainer bxwaitbxfindchildrenbxvisualidpopupwindowbtnorder sitedir functionvotevalue bxajaxpost bitrixcomponentsbitrixiblockvotecomponentphpvar voteid0 overlayarparamsvoteid voteid arparamsratingbxcreatespan htmldocumentgetelementbyidparentid ifobcontainernull autohide trueqntitems bxfindchildrenbxvisualiddocumentgetelementbyidhitvoter1i ifmydivsavedclassnamer2 function10px titlebar contentqntitemslength fori 0r dividmatchhitvoteddr dividmatchdiscvotedd vararparams cursetparamsmydivclassname mydivsavedclassnameoffsettopbxajaxpostmydivclassname staractive staroverwndscrollscrolltop wndsizeinnerheightdividmatchdiscvotedddiademaelse qntitemsdividmatchhitvotedd var voteidcursetparams windowarsetparamsobjobj2 bxpropsseti mydiv documentgetelementbyidhitvoter1iifmydivclassnamestaractive starover0 i closelengthifofferslist true bxaddclassbxvisualidtop 10px titlebarstaractive starover elseodeoncloseicon right 10pxarparamsrating votevalueforvarvisualiddss001 6wifclose 0 closelengthsetwindowoffsetheight2 setwindowstyleleftr1 var votevalueifmydivmoreoptions ifofferslistifofferslistright6wnull arparamstrue ifqntitems 0dividmatchdiscvotedd varonafterpopupshowvar r dividmatchhitvoteddforvar objoverlayifofferslist trueifbxvisualid info bxajaxpostbxpropssetpopup bxpopupwindowmanagercreatevisualidifwindowarsetparams forvar objifmydivsavedclass0 this elsearparamsvote y arparamsvoteid0 0arparams var rcdocumentgetelementbyidnewvoter1i ifmydivdividmatchnewvotedd var voteidbxvisualid ifsetwindowofferslist falseifwindowarsetparamsobjhasownpropertyobj2 ifobj2 visualidnbsp nbsppopupwindowcloseicon true ifcloseifsetwindow popuptop wndscrollscrolltopbxpropssetpopupbxpropssetqntitemslength forirbxcreatespanpx setwindowstyletop popuptopcontent0 closelengthpxifbxvisualidifobj2 visualidifwindowarsetparamshasownpropertyobj forvarwndscroll bxgetwindowscrollposbxaddclassbxvisualid offerslistpopuptopfunction ifbxvisualid infof 5w 3300kwindowarsetparamsobj ifwindowarsetparamsobjhasownpropertyobj2elsetoptrue3300kbxwait parentidinnerhtml bxmessagejscoreloadingdocumentcreateelementdiv obresultinnerhtml dataobresultinnerhtml datanulldocumentgetelementbyidhitvoter1i ifmydiv ifflagdividmatchhitvotedddocumentgetelementbyiddiscvoter1i ifmydivdiadema foffsetleft 0offerslist close bxfindchildrenbxvisualidsetwindowstyleleft100 draggable falsewindowarsetparamsobjobj2 bxpropsset popupbxwait parentidinnerhtmlmydiv documentgetelementbyidhitvoter1ifalse ifwindowarsetparamsifwindowarsetparamsobjhasownpropertyobj2 ifobj2mydiv documentgetelementbyiddiscvoter1iinfosetwindowoffsetwidth2 px setwindowstyletopbxpopupwindowmanagercreatevisualid null autohidefori 0ifobcontainerarparams handler 0parentid arparamsifobj2obresultinnerhtml data obcontainerparentnodereplacechildobresultfirstchildtop 10pxdovote functiondiv parentidoffsetleft 0 offsettopobcontainer documentgetelementbyidparentidarparams varr21ifflag ifmydivsavedclass mydivsavedclassname0 offsettopthissetcontentresult setwindow5wsitedir functionbxfindchildrenbxvisualid classname quantitydocumentcreateelementdiv obresultinnerhtmlfunctiondiv0 ibxdelegatefunctionresult varelementidvalue bxaddclassbxvisualidofferslist false ifwindowarsetparamsdividmatchhitvotedd varcloselength i closeiinnerhtmlpopuptop 0 popuptopmydiv documentgetelementbyidnewvoter1idocumentgetelementbyidhitvoter1idraggableforvar obj2bxpropssetpopupshowr dividmatchdiscvoteddbxajaxpost bitrixcomponentsbitrixiblockvotecomponentphpwhilemydiv documentgetelementbyiddiscvoter1i ifmydivsavedclassnamepopup moreoptions ifofferslistsetwindowstyletophandler 0 istaractivewndscrollscrolltopvoteid arparamsrating0 i qntitemslengthobresultinnerhtml

Longtail Keyword Density for Elektrostandard.net

KeywordsOccurences
ifmydivsavedclassname mydivclassname mydivsavedclassname48
mydivsavedclassname mydivclassname mydivsavedclassname48
mydivclassname mydivsavedclassname mydivclassname48
function handlerdata var24
r2 function handlerdata24
handlerdata var obcontainer24
var obcontainer documentgetelementbyidparentid24
documentgetelementbyidparentid ifobcontainer var24
obcontainer documentgetelementbyidparentid ifobcontainer24
votevalue r2 function24
var votevalue r224
voteid r1 var24
var voteid r124
r1 var votevalue24
bitrixcomponentsbitrixiblockvotecomponentphp arparams handler24
arparams var r24
ifobcontainer var obresult24
bxajaxpost bitrixcomponentsbitrixiblockvotecomponentphp arparams24
var obresult documentcreateelementdiv24
arparamsvote y arparamsvoteid24
bxmessagejscoreloading arparamsvote y24
bxparentidinnerhtml bxmessagejscoreloading arparamsvote24
y arparamsvoteid voteid24
arparamsvoteid voteid arparamsrating24
arparamsrating votevalue bxajaxpost24
voteid arparamsrating votevalue24
bxmessagejscoreloading bxparentidinnerhtml bxmessagejscoreloading24
parentidinnerhtml bxmessagejscoreloading bxparentidinnerhtml24
obresultinnerhtml data obcontainerparentnodereplacechildobresultfirstchild24
documentcreateelementdiv obresultinnerhtml data24
obresult documentcreateelementdiv obresultinnerhtml24
data obcontainerparentnodereplacechildobresultfirstchild obcontainer24
obcontainerparentnodereplacechildobresultfirstchild obcontainer bxwait24
bxwait parentidinnerhtml bxmessagejscoreloading24
obcontainer bxwait parentidinnerhtml24
parentid arparams var24
dovote functiondiv parentid24
mydivclassname ifmydivclassnamestar-active star-over24
ifmydivclassnamestar-active star-over mydivclassname24
star-over mydivclassname star-active24
mydivclassname star-active star-over24
mydivsavedclassname mydivclassname ifmydivclassnamestar-active24
functiondiv parentid arparams24
0 i-- mydiv24
ifmydiv ifflag ifmydivsavedclass24
ifflag ifmydivsavedclass mydivsavedclassname24
star-active star-over else24
ifmydivsavedclass mydivsavedclassname mydivclassname24
star-over else ifmydivsavedclassname24
mydivsavedclassname i dovote24
votevalue bxajaxpost bitrixcomponentsbitrixiblockvotecomponentphp24
else ifmydivsavedclassname mydivclassname24
mydivsavedclassname i r2124
handler 0 i--20
arparams handler 020
nbsp nbsp nbsp19
r21 whilemydiv documentgetelementbyidhitvoter1i8
documentgetelementbyidhitvoter1i ifmydivsavedclassname mydivclassname8
whilemydiv documentgetelementbyidhitvoter1i ifmydivsavedclassname8
i-- mydiv documentgetelementbyidhitvoter1i8
var r dividmatchhitvotedd8
mydiv documentgetelementbyidhitvoter1i ifmydiv8
documentgetelementbyidhitvoter1i ifmydiv ifflag8
i-- mydiv documentgetelementbyiddiscvoter1i8
whilemydiv documentgetelementbyiddiscvoter1i ifmydivsavedclassname8
var r dividmatchdiscvotedd8
documentgetelementbyiddiscvoter1i ifmydiv ifflag8
mydiv documentgetelementbyiddiscvoter1i ifmydiv8
dividmatchhitvotedd var voteid8
documentgetelementbyiddiscvoter1i ifmydivsavedclassname mydivclassname8
r dividmatchhitvotedd var8
r21 whilemydiv documentgetelementbyiddiscvoter1i8
mydiv documentgetelementbyidnewvoter1i ifmydiv8
i-- mydiv documentgetelementbyidnewvoter1i8
dividmatchdiscvotedd var voteid8
r dividmatchdiscvotedd var8
dividmatchnewvotedd var voteid8
documentgetelementbyidnewvoter1i ifmydiv ifflag8
r dividmatchnewvotedd var8
var r dividmatchnewvotedd8
documentgetelementbyidnewvoter1i ifmydivsavedclassname mydivclassname8
whilemydiv documentgetelementbyidnewvoter1i ifmydivsavedclassname8
r21 whilemydiv documentgetelementbyidnewvoter1i8
true ifclose 06
popup-window-close-icon true ifclose6
ifclose 0 closelength6
classname popup-window-close-icon true6
closelength i closeiinnerhtml6
0 i closelength6
0 closelength fori6
closelength fori 06
100 draggable false5
events onafterpopupshow function5
opacity 100 draggable5
0 overlay opacity5
0 offsettop 05
offsettop 0 overlay5
overlay opacity 1005
false closeicon right5
top -10px titlebar5
content events onafterpopupshow5
offsetleft 0 offsettop5
-10px top -10px5
right -10px top5
closebyesc false closeicon5
closeicon right -10px5
false closebyesc false5
draggable false closebyesc5
popup null arparams5
true offsetleft 05
null autohide true5
autohide true offsetleft5
ifsetwindow popuptop wndscrollscrolltop4
popuptop wndscrollscrolltop wndsizeinnerheight4
elektrostandard dskr81 5w4
html content events4
bxdelegatefunctionresult var wndscroll4
wndscrollscrolltop wndsizeinnerheight setwindowoffsetheight24
bxgetwindowscrollpos wndsize bxgetwindowinnersize4
setwindow popuptop thissetcontentresult4
popuptop thissetcontentresult setwindow4
bxgetwindowinnersize setwindow popuptop4
wndsize bxgetwindowinnersize setwindow4
wndscroll bxgetwindowscrollpos wndsize4
bxcreatespan html content4
var wndscroll bxgetwindowscrollpos4
content bxcreatespan html4
setwindowoffsetwidth2 px setwindowstyletop4
wndsizeinnerwidth setwindowoffsetwidth2 px4
px setwindowstyletop popuptop4
setwindowstyletop popuptop 04
popuptop 0 popuptop4
popuptop px 04
setwindowstyleleft wndsizeinnerwidth setwindowoffsetwidth24
-10px titlebar content4
titlebar content bxcreatespan4
wndsizeinnerheight setwindowoffsetheight2 setwindowstyleleft4
setwindowoffsetheight2 setwindowstyleleft wndsizeinnerwidth4
0 this else4
0 popuptop px4
classname quantity true3
bxfindchildrenbxvisualid classname quantity3
quantity true ifqntitems3
ifqntitems 0 qntitemslength3
moreoptions ifofferslist true3
ifofferslist true bxaddclassbxvisualid3
true bxaddclassbxvisualid offers-list3
pop-up moreoptions ifofferslist3
bxaddclassbxvisualid pop-up moreoptions3
qntitemslength i qntitemsivalue3
elementidvalue bxaddclassbxvisualid pop-up3
bxaddclassbxvisualid offers-list close3
offers-list close bxfindchildrenbxvisualid3
qntitemslength fori 03
0 qntitemslength fori3
0 i qntitemslength3
qntitems bxfindchildrenbxvisualid classname3
close bxfindchildrenbxvisualid classname3
bxfindchildrenbxvisualid classname popup-window-close-icon3
true ifqntitems 03
bxpropsset popup null3
false ifwindowarsetparams forvar3
offerslist false ifwindowarsetparams3
offerslist offerslist false3
ifwindowarsetparams forvar obj3
obj in windowarsetparams3
obj2 in windowarsetparamsobj3
ifwindowarsetparamshasownpropertyobj forvar obj23
windowarsetparams ifwindowarsetparamshasownpropertyobj forvar3
offerslist offerslist offerslist3
elementid offerslist offerslist3
arparams handler var3
f 5w 3300k3
cdw f 5w3
bxmessage additemincartadded popupwindowtitle3
additemincartadded popupwindowtitle popupwindowbtnclose3
popupwindowbtnorder sitedir function3
popupwindowbtnclose popupwindowbtnorder sitedir3
popupwindowtitle popupwindowbtnclose popupwindowbtnorder3
windowarsetparamsobj ifwindowarsetparamsobjhasownpropertyobj2 ifobj23
ifwindowarsetparamsobjhasownpropertyobj2 ifobj2 visualid3
ifbxvisualid info bxajaxpost3
function ifbxvisualid info3
onafterpopupshow function ifbxvisualid3
arparams cursetparams bxdelegatefunctionresult3
cursetparams bxdelegatefunctionresult var3
bxvisualid ifsetwindow popuptop3
setwindow bxvisualid ifsetwindow3
thissetcontentresult setwindow bxvisualid3
bxpopupwindowmanagercreatevisualid null autohide3
bxpropssetpopup bxpopupwindowmanagercreatevisualid null3
var cursetparams windowarsetparamsobjobj23
visualid var cursetparams3
ifobj2 visualid var3
cursetparams windowarsetparamsobjobj2 bxpropsset3
windowarsetparamsobjobj2 bxpropsset popup3
arparams bxpropssetpopup bxpopupwindowmanagercreatevisualid3
null arparams bxpropssetpopup3
else qntitems bxfindchildrenbxvisualid3
mydivclassname mydivsavedclassname96
mydivsavedclassname mydivclassname72
ifmydivsavedclassname mydivclassname48
r2 function24
votevalue r224
function handlerdata24
var obcontainer24
documentgetelementbyidparentid ifobcontainer24
obcontainer documentgetelementbyidparentid24
var votevalue24
handlerdata var24
voteid r124
parentid arparams24
functiondiv parentid24
dovote functiondiv24
arparams var24
var r24
ifobcontainer var24
var voteid24
r1 var24
var obresult24
arparamsvoteid voteid24
y arparamsvoteid24
arparamsvote y24
bxmessagejscoreloading arparamsvote24
voteid arparamsrating24
votevalue bxajaxpost24
arparams handler24
bitrixcomponentsbitrixiblockvotecomponentphp arparams24
bxajaxpost bitrixcomponentsbitrixiblockvotecomponentphp24
bxparentidinnerhtml bxmessagejscoreloading24
bxmessagejscoreloading bxparentidinnerhtml24
obresultinnerhtml data24
documentcreateelementdiv obresultinnerhtml24
obresult documentcreateelementdiv24
data obcontainerparentnodereplacechildobresultfirstchild24
obcontainerparentnodereplacechildobresultfirstchild obcontainer24
parentidinnerhtml bxmessagejscoreloading24
bxwait parentidinnerhtml24
obcontainer bxwait24
r21 whilemydiv24
arparamsrating votevalue24
ifmydivclassnamestar-active star-over24
i-- mydiv24
mydivclassname ifmydivclassnamestar-active24
ifmydivsavedclass mydivsavedclassname24
ifflag ifmydivsavedclass24
0 i--24
star-over mydivclassname24
else ifmydivsavedclassname24
star-over else24
star-active star-over24
ifmydiv ifflag24
mydivclassname star-active24
handler 020
nbsp nbsp20
fori 09
dividmatchhitvotedd var8
documentgetelementbyidnewvoter1i ifmydivsavedclassname8
documentgetelementbyidhitvoter1i ifmydivsavedclassname8
mydiv documentgetelementbyiddiscvoter1i8
dividmatchdiscvotedd var8
documentgetelementbyiddiscvoter1i ifmydivsavedclassname8
r dividmatchdiscvotedd8
r dividmatchhitvotedd8
documentgetelementbyiddiscvoter1i ifmydiv8
documentgetelementbyidhitvoter1i ifmydiv8
r dividmatchnewvotedd8
dividmatchnewvotedd var8
mydiv documentgetelementbyidnewvoter1i8
documentgetelementbyidnewvoter1i ifmydiv8
whilemydiv documentgetelementbyidnewvoter1i8
mydiv documentgetelementbyidhitvoter1i8
whilemydiv documentgetelementbyidhitvoter1i8
whilemydiv documentgetelementbyiddiscvoter1i8
offerslist offerslist6
bxfindchildrenbxvisualid classname6
popup-window-close-icon true6
true ifclose6
0 closelength6
ifclose 06
eurosvet 29363-836
classname popup-window-close-icon6
dskr81 5w6
closelength fori6
0 overlay5
null arparams5
overlay opacity5
opacity 1005
offsettop 05
5w 3300k5
offsetleft 05
100 draggable5
autohide true5
null autohide5
true offsetleft5
closebyesc false5
-10px titlebar5
top -10px5
content events5
events onafterpopupshow5
onafterpopupshow function5
-10px top5
right -10px5
false closebyesc5
popup null5
false closeicon5
closeicon right5
draggable false5
0 offsettop5
px setwindowstyletop4
setwindowstyletop popuptop4
setwindowoffsetwidth2 px4
bxdelegatefunctionresult var4
var wndscroll4
popuptop 04
0 popuptop4
html content4
elektrostandard dskr814
setwindowoffsetheight2 setwindowstyleleft4
5w 4200k4
wndscroll bxgetwindowscrollpos4
bxgetwindowscrollpos wndsize4
ifsetwindow popuptop4
setwindowstyleleft wndsizeinnerwidth4
popuptop wndscrollscrolltop4
wndscrollscrolltop wndsizeinnerheight4
wndsizeinnerheight setwindowoffsetheight24
wndsizeinnerwidth setwindowoffsetwidth24
thissetcontentresult setwindow4
wndsize bxgetwindowinnersize4
bxgetwindowinnersize setwindow4
setwindow popuptop4
popuptop thissetcontentresult4
bxcreatespan html4
content bxcreatespan4
odeon light4
popuptop px4
0 14
px 04
titlebar content4
elektrostandard elektrostandard4
ifqntitems 03
0 qntitemslength3
qntitemslength fori3
true ifqntitems3
classname quantity3
else qntitems3
elementidvalue bxaddclassbxvisualid3
quantity true3
moreoptions ifofferslist3
offers-list close3
close bxfindchildrenbxvisualid3
closeiinnerhtml bxpropssetpopupshow3
bxaddclassbxvisualid offers-list3
true bxaddclassbxvisualid3
pop-up moreoptions3
qntitems bxfindchildrenbxvisualid3
ifofferslist true3
bxaddclassbxvisualid pop-up3
forvar obj23
popupwindowbtnorder sitedir3
popupwindowbtnclose popupwindowbtnorder3
popupwindowtitle popupwindowbtnclose3
additemincartadded popupwindowtitle3
sitedir function3
elementid offerslist3
ifwindowarsetparams forvar3
false ifwindowarsetparams3
offerslist false3
bxmessage additemincartadded3
handler var3
f 5w3
cdw f3
0 33
dss001 6w3
dsk80 5w3
0 03
diadema f3
220 803
forvar obj3
windowarsetparams ifwindowarsetparamshasownpropertyobj3
function ifbxvisualid3
bxpopupwindowmanagercreatevisualid null3
bxpropssetpopup bxpopupwindowmanagercreatevisualid3
ifbxvisualid info3
info bxajaxpost3
setwindow bxvisualid3
cursetparams bxdelegatefunctionresult3
arparams cursetparams3
arparams bxpropssetpopup3
bxpropsset popup3
ifwindowarsetparamsobjhasownpropertyobj2 ifobj23
windowarsetparamsobj ifwindowarsetparamsobjhasownpropertyobj23
ifwindowarsetparamshasownpropertyobj forvar3
ifobj2 visualid3
visualid var3
windowarsetparamsobjobj2 bxpropsset3
cursetparams windowarsetparamsobjobj23
var cursetparams3
bxvisualid ifsetwindow3
var158
mydivclassname144
mydivsavedclassname120
085
arparams58
obcontainer48
voteid48
star-over48
bxmessagejscoreloading48
ifmydivsavedclassname48
votevalue48
function39
new35
else30
bxajaxpost29
true25
star-active24
mydiv24
arparamsrating24
r2124
whilemydiv24
ifmydiv24
ifmydivclassnamestar-active24
bitrixcomponentsbitrixiblockvotecomponentphp24
handler24
dovote24
i--24
ifflag24
ifmydivsavedclass24
parentid24
documentcreateelementdiv24
obresult24
ifobcontainer24
obresultinnerhtml24
data24
parentidinnerhtml24
obcontainerparentnodereplacechildobresultfirstchild24
documentgetelementbyidparentid24
arparamsvote24
r24
arparamsvoteid24
bxparentidinnerhtml24
y24
r124
handlerdata24
r224
functiondiv24
bxwait24
elektrostandard23
nbsp21
false17
documentgetelementbyiddiscvoter1i16
popuptop16
documentgetelementbyidnewvoter1i16
documentgetelementbyidhitvoter1i16
closelength12
5w12
null10
-10px10
eurosvet10
offerslist9
fori9
content9
px9
classname9
f9
18
dividmatchdiscvotedd8
setwindow8
dividmatchnewvotedd8
28
dividmatchhitvotedd8
luminex7
forvar7
cursetparams6
qntitemslength6
29363-836
popup-window-close-icon6
bxfindchildrenbxvisualid6
dskr816
close6
closeiinnerhtml6
pop-up6
4200k6
ifclose6
bxaddclassbxvisualid6
events5
onafterpopupshow5
bxdelegatefunctionresult5
autohide5
popup5
opacity5
right5
top5
titlebar5
closeicon5
closebyesc5
offsettop5
overlay5
draggable5
offsetleft5
thissetcontentresult5
3300k5
lussole5
html4
light4
setwindowoffsetwidth24
odeon4
bxcreatespan4
34
wndsizeinnerwidth4
eastec4
setwindowstyletop4
wndsize4
bxgetwindowscrollpos4
bxgetwindowinnersize4
wndscrollscrolltop4
ifsetwindow4
setwindowoffsetheight24
wndsizeinnerheight4
wndscroll4
setwindowstyleleft4
ifofferslist3
qntitemsivalue3
elementidvalue3
moreoptions3
ifbxvisualid3
offers-list3
info3
bxvisualid3
quantity3
bxpropssetpopupshow3
qntitems3
ifqntitems3
windowarsetparamsobj3
43
cdw3
53
63
nbl3
c3
alfa3
bogates3
dss0013
6w3
diadema3
73
units3
nanothermal3
83
dsk803
93
103
113
bxmessage3
ifwindowarsetparamsobjhasownpropertyobj23
obj23
ifwindowarsetparamshasownpropertyobj3
ifobj23
visualid3
bxpropssetpopup3
bxpropsset3
windowarsetparamsobjobj23
windowarsetparams3
obj3
popupwindowbtnclose3
popupwindowtitle3
additemincartadded3
popupwindowbtnorder3
sitedir3
ifwindowarsetparams3
elementid3
bxpopupwindowmanagercreatevisualid3

What are the nameservers for elektrostandard.net?

Elektrostandard.net Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown