Elvislives.net Favicon Elvislives.net

Elvislives.net Website Thumbnail
Checking...
Lajupoker: Situs Judi QQ IDN Poker Online Terpercaya 2020
Low trust score
Add a review Change category Claim this site
Lajupoker adalah situs judi qq idn poker online mudah menang terpercaya 2020 uang asli, menyediakan permainan dominoqq, ceme keliling, capsa susun terbaik.


Domain summary

Domain label
elvislives
Domain extension
net
Domain registered:
2019-05-12
Domain updated:
2020-07-10
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is elvislives.net ranked relative to other sites:

Percentage of visits to elvislives.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Elvislives.net registered?
A: Elvislives.net was registered 1 year, 4 months, 1 week, 6 days, 3 hours, 51 minutes, 38 seconds ago on Sunday, May 12, 2019.
Q: When was the WHOIS for Elvislives.net last updated?
A: The WHOIS entry was last updated 2 months, 2 weeks, 1 day, 3 hours, 51 minutes, 38 seconds ago on Friday, July 10, 2020.
Q: What are Elvislives.net's nameservers?
A: DNS for Elvislives.net is provided by the following nameservers:
  • bradley.ns.cloudflare.com
  • sharon.ns.cloudflare.com
Q: Who is the registrar for the Elvislives.net domain?
A: The domain has been registered at GODADDY.COM, LLC.
Q: What is the traffic rank for Elvislives.net?
A: Elvislives.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Elvislives.net each day?
A: Elvislives.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Elvislives.net resolve to?
A: Elvislives.net resolves to the IPv4 address 104.31.91.216.
Q: In what country are Elvislives.net servers located in?
A: Elvislives.net has servers located in the United States.
Q: What webserver software does Elvislives.net use?
A: Elvislives.net is powered by CloudFlare webserver.
Q: Who hosts Elvislives.net?
A: Elvislives.net is hosted by TOT Public Company Limited in United States.
Q: How much is Elvislives.net worth?
A: Elvislives.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Elvislives.net?

Elvislives.net Hosting Provider Information

Hosted IP Address:104.31.91.216
Hosted Hostname:104.31.91.216
Service Provider:TOT Public Company Limited
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "TOT Public Company Limited" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Elvislives.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 26 Aug 2020 15:50:19 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding,User-Agent
Last-Modified: Wed, 26 Aug 2020 12:27:24 GMT
Cache-Control: max-age=0
Expires: Wed, 26 Aug 2020 15:50:19 GMT
CF-Cache-Status: DYNAMIC
cf-request-id: 04cd0f91c50000e66083125200000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 5c8eb52fab9be660-LHR
Content-Encoding: gzip

Elvislives.net Domain Nameserver Information

HostIP AddressCountry
bradley.ns.cloudflare.com 162.159.44.35
sharon.ns.cloudflare.com 108.162.192.221


Need to find out who hosts Elvislives.net?


WhoIs information for Elvislives.net

 Domain Name: ELVISLIVES.NET
Registry Domain ID: 2389996881_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2020-05-13T07:20:01Z
Creation Date: 2019-05-12T13:18:14Z
Registry Expiry Date: 2021-05-12T13:18:14Z
Registrar: NameCheap, Inc.
Registrar IANA ID: 1068
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.6613102107
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: DNS101.REGISTRAR-SERVERS.COM
Name Server: DNS102.REGISTRAR-SERVERS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-06-17T14:13:02Z

Elvislives.net Free SEO Report

Website Inpage Analysis for Elvislives.net

H1 Headings

1 :
  1. Situs Judi QQ IDN Poker Online Terpercaya

H2 Headings

3 :
  1. Keseruan Bermain di Situs Judi Online Idn Poker QQ
  2. Daftar Poker QQ Online Indonesia
  3. Jenis Judi Kartu di IDN Play

H3 Headings

2 :
  1. Cara Bermain Judi di Situs Lajupoker
  2. Agen Judi Online Terbaik dan Profesional

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

22 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-159357332-3

Links - Internal

25:
  1. No text
    http://elvislives.net/
  2. DAFTAR
    http://elvislives.net/daftar
  3. LOGIN
    http://elvislives.net/login
  4. Live Chat
    http://elvislives.net/livechat
  5. Beranda
    https://www.elvislives.net/
  6. Tentang Kami
    https://www.elvislives.net/tentang-kami/
  7. Cara Deposit
    https://www.elvislives.net/deposit/
  8. Cara Withdraw
    https://www.elvislives.net/withdraw/
  9. Bonus / Jackpot
    https://www.elvislives.net/bonus/
  10. Poker
    https://www.elvislives.net/poker/
  11. Domino
    https://www.elvislives.net/domino/
  12. Capsa
    https://www.elvislives.net/capsa/
  13. Ceme
    https://www.elvislives.net/ceme/
  14. Ceme Keliling
    https://www.elvislives.net/ceme-keliling/
  15. Super10
    https://www.elvislives.net/super10/
  16. More...
    http://elvislives.net/jackpot/
  17. deposit
    http://elvislives.net/deposit/
  18. withdraw
    http://elvislives.net/withdraw/
  19. judi poker qq online
    http://elvislives.net/
  20. Bandar ceme
    https://www.elvislives.net/ceme/
  21. Ceme keliling
    https://www.elvislives.net/ceme-keliling/
  22. Capsa susun
    https://www.elvislives.net/capsa/
  23. poker online
    http://elvislives.net/
  24. IDN Poker
    http://elvislives.net/
  25. Lajupoker: Situs Judi QQ IDN Poker Online Terpercaya 2020
    http://elvislives.net/

Links - Internal (nofollow)

0:

Links - Outbound

2:
  1. lajupokerqq
    https://www.facebook.com/lajupokerqq
  2. @LajuPoker
    https://twitter.com/@LajuPoker

Links - Outbound (nofollow)

0:

Keyword Cloud for Elvislives.net

sepertisaat andakartuyang dimerasakanjanganada banyakmembuat andabanyak pemain yangdengan menggunakanbaiksulit untukbagisitus judipermainanpermainan yangmemilikibermain denganjudi onlineuntuk bermain judi1saat anda akansehinggaditerbaruanda harusdengan idadaberjalanyang tidakmudahuntuk andapemain yangyang satu iniakan memilihyang andayang gratiswaktumemberikansangatmenang dalamjika andadaftar pokersertataruhan uangyang satubeberapabagaimanadepositsebagaiini makabaik dandenganonlinekesempatanataudanpermainan judisebuahbermain judiidn pokersalah satupadajudi kartu pokermenangini jugatempatmemilihjadidariid yangyang merupakanhalcemegratisjudi online yangbermain yangini denganitubisaonline terpercayatidakakan jadikinionline yang satukartu pokeryang sangatbagi pemainanda lakukanbanyak pemainbutuhkantempat bermainpoker onlineakan membuatmaka andabahkansitus judi yangkarenadapat andasudahuntukyang akandengan sangatyangjikajuga untukakanuangmenggunakanonline inisaatuntuk bermainhanyakesempatan untukini danbermain judi didalam permainanpoker qqdi situsawalpemaincurangdalam permainan judipermainan judi yangkelilinguntuk permainanharusdapatbesaragentanpa modalsitus judi onlinemenemukanyang bisapoker online inianda yangasliyang berbedaandauntuk permainan judipoker online yangfalseidmaulebihtaruhan uang aslidapat anda lakukansitusbermain judi pokerpermainan judi pokeridndaftarjudi poker onlineanda akanyang dapatsajayang adaqq onlinebanyakterusuang asliuntuk menangnamunbukansatudi butuhkanmembuatinibermain judi inikeuntunganmelakukanmenjadibermain diagen judilakukanpermainan judi kartujudi pokerdimainkantruesulitlajupokeranda jugatanpajudi inibonusjudi qqmendapatkanqqterpercayacaraselamajugabermaintentangmerupakanberjalan dengantidak akandisinisalahpada saatadalahkesempatan untuk bermainbermain judi onlinememangstrategijudi kartuwaktu yangsatu iniberbedaceme kelilingtaruhanmenang dalam permainanmakakeuntungan yanghal yangjudi dicara untukmodaljudimainkanyang akan membuatonline yangjudi yanganda mainkan0terbaikpertamapermainan judi onlinemaka anda akananda bermaindalamresmiprofesionalpokeranda untukini karena

Longtail Keyword Density for Elvislives.net

KeywordsOccurences
judi poker online17
poker online yang9
permainan judi kartu7
permainan judi yang7
dalam permainan judi6
bermain judi poker6
judi online yang5
permainan judi poker5
maka anda akan5
menang dalam permainan5
permainan judi online5
situs judi online4
bermain judi ini4
saat anda akan4
untuk bermain judi4
online yang satu4
untuk permainan judi4
banyak pemain yang3
poker online ini3
dapat anda lakukan3
situs judi yang3
judi kartu poker3
bermain judi di3
taruhan uang asli3
kesempatan untuk bermain3
bermain judi online3
yang akan membuat3
yang satu ini3
permainan judi31
poker online26
bermain judi19
judi poker18
judi online16
online yang15
situs judi13
yang akan11
judi yang11
anda akan11
judi kartu10
judi ini9
dalam permainan8
saat anda7
yang anda7
permainan yang7
tidak akan7
ada banyak6
untuk anda6
pemain yang6
maka anda6
anda lakukan6
judi qq6
idn poker6
anda yang6
agen judi6
untuk bermain6
uang asli5
akan membuat5
menang dalam5
di situs5
dapat anda5
tanpa modal5
anda bermain5
yang dapat5
poker qq5
bermain dengan4
taruhan uang4
yang satu4
bermain yang4
online ini4
yang di4
tempat bermain4
yang ada4
yang berbeda4
online terpercaya4
yang sangat4
kesempatan untuk4
keuntungan yang4
untuk permainan4
anda mainkan4
bermain di4
anda harus3
cara untuk3
kartu poker3
yang tidak3
akan memilih3
daftar poker3
ceme keliling3
untuk menang3
ini karena3
hal yang3
yang gratis3
banyak pemain3
berjalan dengan3
satu ini3
baik dan3
dengan id3
id yang3
ini dengan3
di butuhkan3
akan jadi3
dengan sangat3
sulit untuk3
yang bisa3
membuat anda3
pada saat3
ini juga3
ini dan3
anda juga3
waktu yang3
judi di3
salah satu3
ini maka3
qq online3
bagi pemain3
dengan menggunakan3
yang merupakan3
anda untuk3
jika anda3
juga untuk3
yang111
judi82
anda74
online47
permainan45
akan44
bermain41
poker38
untuk36
ini32
dan30
dengan28
di22
juga21
dapat20
pemain20
situs19
ada17
saat13
dalam13
banyak12
tidak12
sangat12
qq11
uang10
agen10
maka10
kartu10
modal9
menang9
bisa9
bagi9
satu9
lajupoker9
harus8
karena8
cara8
membuat8
pada8
idn8
taruhan7
menggunakan7
jika7
daftar7
07
hal7
deposit7
memang6
true6
memiliki6
lakukan6
hanya6
bonus6
tanpa6
adalah6
tempat6
dari6
saja6
melakukan6
terpercaya5
atau5
gratis5
asli5
strategi5
namun5
keuntungan5
mainkan5
kesempatan5
id5
berbeda4
mendapatkan4
curang4
kini4
resmi4
bahkan4
sehingga4
memilih4
awal4
sudah4
menjadi4
baik4
memberikan4
ceme4
terbaik4
waktu4
sulit4
itu4
butuhkan4
selama4
mudah4
berjalan3
besar3
serta3
bukan3
dimainkan3
terus3
sebagai3
pertama3
merasakan3
bagaimana3
jadi3
salah3
terbaru3
merupakan3
keliling3
beberapa3
menemukan3
disini3
seperti3
sebuah3
tentang3
profesional3
jangan3
false3
13
lebih3
mau3

Elvislives.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Elvislives.net is a scam?

Websites with Similar Names

Elvis-ag.com
ELVIS Home
Elvis-art.com
Welcome at Elvis Art by Rob de Vries
Elvis-collection.com
Gigantic Private Elvis Presley Collection - Home
Elvis-collectors.com
For Elvis CD Collectors Only
Elvis-duo.dk
Elvis Duo
Elvis-express.com
ELVIS EXPRESS RADIO NEWS 2020/02
Elvis-l.com
Elvis Lamoureux •
Elvis-lee-design.com
elvis-lee-design

Recently Updated Websites

Fultoncountytitle.com 2 seconds ago.Divergenceclothing.com 2 seconds ago.Doriankingi.com 2 seconds ago.Lyfteacher.com 4 seconds ago.Twoweeknoticeproductions.com 4 seconds ago.Adventure365store.com 4 seconds ago.Fun-taiwan.com.tw 4 seconds ago.Fallforart.org 4 seconds ago.Cajundetective.com 4 seconds ago.Kraususa.com 4 seconds ago.Cnshutter.com 5 seconds ago.Dsaokc.org 5 seconds ago.Brownpetro.com 5 seconds ago.Eliteformations.com 5 seconds ago.Getpennpaper.com 6 seconds ago.Conseillersintersources.net 6 seconds ago.Pon-luxurycars.com 6 seconds ago.Coggles.com 6 seconds ago.Itkcash.com 7 seconds ago.Grasspacker.com 7 seconds ago.Fightshift.com 8 seconds ago.Notmynumber.net 8 seconds ago.Cooperfuneralhomemedina.com 8 seconds ago.Autonoleggio-online.it 8 seconds ago.Savarkar.org 8 seconds ago.Thebandmanstore.com 9 seconds ago.Tojamistixup.com 10 seconds ago.Aemgroup.org 11 seconds ago.Weblew.com 11 seconds ago.Merseywavemusic.com 12 seconds ago.