Billig VVS & Elartikler | Køb billige el & VVS artikler online

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: Shopping

Billige el artikler & billig VVS til Engros priser. Klik dig videre og se vores tilbud på kvalitetsvarer indenfor El & VVS, samt alt i lyskilder og belysning her. Vi er naturligvis E-mærket, og har Prismatch og Gratis Fragt over 699,00 kr.



Domain summary

Last updated
2021-04-26
Domain label
elvvs
Domain extension
dk
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Elvvs.dk registered?
A: Elvvs.dk was registered 5 months, 2 days, 7 hours, 46 minutes, 53 seconds ago on Monday, April 26, 2021.
Q: When was the WHOIS for Elvvs.dk last updated?
A: The WHOIS entry was last updated 5 months, 2 days, 7 hours, 46 minutes, 53 seconds ago on Monday, April 26, 2021.
Q: What are Elvvs.dk's nameservers?
A: DNS for Elvvs.dk is provided by the following nameservers:
  • ns2.scannet2.dk
  • ns.scannet2.dk
Q: Who is the registrar for the Elvvs.dk domain?
A: The domain has been registered at .
Q: What is the traffic rank for Elvvs.dk?
A: Elvvs.dk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Elvvs.dk each day?
A: Elvvs.dk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Elvvs.dk resolve to?
A: Elvvs.dk resolves to the IPv4 address 185.21.40.227.
Q: In what country are Elvvs.dk servers located in?
A: Elvvs.dk has servers located in the Denmark.
Q: What webserver software does Elvvs.dk use?
A: Elvvs.dk is powered by Nginx webserver.
Q: Who hosts Elvvs.dk?
A: Elvvs.dk is hosted by ZITCOM A/S in Denmark.
Q: How much is Elvvs.dk worth?
A: Elvvs.dk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Elvvs.dk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Elvvs.dk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Elvvs.dk

H1 Headings

1 :
  1. Billig VVS og elartikler med prismatch

H2 Headings

2 :
  1. Garant for billig VVS og elartikler
  2. Log ind

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

27 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

52:

Links - Internal (nofollow)

0:

Links - Outbound

3:

Links - Outbound (nofollow)

0:

Keyword Cloud for Elvvs.dk

tilbudvifritidkundeserviceproduktermenu se altsmart049tilopretkodeordmedled lyskildelyskilde kampagne seelartiklerkabel ampkabelvvs ogaflkse altosvoresledklimabillig vvsblog se altbilligsmart homehosvvs og elartiklersombefstelselog ind medvarhar dueller1erordernummerblogomse herhus ampemaillyskilderkampagnevvsherind medharsamthus amp fritidampkampagne se herlyskilde kampagnevrktj smartrrdintilbehrhomeemail emailkan70 200ihcled lyskilde kampagneloginelparingvvs artiklerkampagne semenu se70 200 049artiklermrker0blog sealtdubelysningetprismatchsedit kodeordlog indlog200 049email email emailkodeord kodeordamp fritidog elartiklervrktjditdiverselyskildedetmenubillig vvs ogindogannullerhus

Longtail Keyword Density for Elvvs.dk

KeywordsOccurences
menu se alt10
blog se alt9
70 200 0494
led lyskilde kampagne4
lyskilde kampagne se4
kampagne se her4
billig vvs og4
vvs og elartikler3
hus amp fritid3
log ind med3
email email email3
se alt20
menu se10
blog se9
email email6
smart home6
log ind6
70 2004
vvs og4
200 0494
kodeord kodeord4
billig vvs4
se her4
kampagne se4
lyskilde kampagne4
led lyskilde4
og elartikler3
kabel amp3
hus amp3
amp fritid3
har du3
ind med3
dit kodeord3
vrktj smart3
vvs artikler3
amp57
og31
se25
alt20
vvs15
vi14
kodeord12
blog11
menu11
med10
led10
vores9
du9
til9
email9
paring8
vrktj8
smart8
el7
ind7
har6
log6
billig6
os6
prismatch6
er6
home6
belysning6
mrker5
befstelse5
kampagne5
lyskilder5
tilbehr5
annuller5
artikler5
klima5
elartikler5
05
produkter5
her4
rr4
el-artikler4
eller4
0494
din4
et4
af4
lyskilde4
det4
hus4
14
fritid4
ihc4
dit3
ordernummer3
opret3
kundeservice3
login3
kan3
diverse3
som3
om3
hos3
lk3
samt3
tilbud3
kabel3
var3

Who hosts Elvvs.dk?

Elvvs.dk Hosting Provider Information

Hosted IP Address:185.21.40.227
Hosted Hostname:vm0763.enterprisecloud.nu
Service Provider:ZITCOM A/S
Hosted Country:DenmarkDK
Location Latitude:55.7123
Location Longitude:12.0564
Webserver Software:nginx

Is "ZITCOM A/S" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
ZITCOM A/S
0.0036%

HTTP Header Analysis for Elvvs.dk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Mon, 26 Apr 2021 00:12:40 GMT
Content-Type: text/html;charset=iso-8859-1
Content-Length: 16016
Connection: keep-alive
X-Powered-By: PleskLin
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Vary: Accept-Encoding
Content-Encoding: gzip

Elvvs.dk Domain Nameserver Information

HostIP AddressCountry
ns2.scannet2.dk 91.197.248.72
ns.scannet2.dk 185.25.141.9


Need to find out who hosts Elvvs.dk?


Domain Registration (WhoIs) information for Elvvs.dk

 # Hello 3.8.139.228. Your session has been logged.
#
# Copyright (c) 2002 - 2021 by DK Hostmaster A/S
#
# Version: 4.0.2
#
# The data in the DK Whois database is provided by DK Hostmaster A/S
# for information purposes only, and to assist persons in obtaining
# information about or related to a domain name registration record.
# We do not guarantee its accuracy. We will reserve the right to remove
# access for entities abusing the data, without notice.
#
# Any use of this material to target advertising or similar activities
# are explicitly forbidden and will be prosecuted. DK Hostmaster A/S
# requests to be notified of any such activities or suspicions thereof.

Domain: elvvs.dk
DNS: elvvs.dk
Registered: 2000-07-06
Expires: 2021-09-30
Registration period: 1 year
VID: no
DNSSEC: Unsigned delegation, no records
Status: Active

Nameservers
Hostname: ns.scannet2.dk
Hostname: ns2.scannet2.dk

Websites with Similar Names

Elvvs.dk
Billig VVS & Elartikler | Køb billige el & VVS artikler online
Elvvshedekas.com
404 Not Found

Recently Updated Websites

Kharmaconsulting.net (13 seconds ago.)Intracte.net (13 seconds ago.)Asimetriq.com (14 seconds ago.)Nhwatches.com (20 seconds ago.)Bancoalimentare.org (21 seconds ago.)Ramiroschere.com (23 seconds ago.)Sixmeatbuffet.com (24 seconds ago.)Tianhua.life (25 seconds ago.)Essex-pharmacy.com (33 seconds ago.)Hotelpremium.net (35 seconds ago.)Terrapro.fr (37 seconds ago.)Officialrickhard.com (38 seconds ago.)1802215.com (38 seconds ago.)Aazap.com (40 seconds ago.)Keithmansfield.co.uk (42 seconds ago.)Syedgakbar.com (47 seconds ago.)Reosiliconvalley.com (48 seconds ago.)Showwiththeco.com (49 seconds ago.)Tasaheeljo.com (49 seconds ago.)Runeastie.com (52 seconds ago.)Slijterijleiden.nl (53 seconds ago.)Millionheirgirlz.com (56 seconds ago.)Ssxxx.top (57 seconds ago.)Pmmnp.com (57 seconds ago.)Absolutepetsitting.org (1 minute 1 second ago.)Suvarnaenterprises.com (1 minute 5 seconds ago.)Dynamiccartsreviews.com (1 minute 6 seconds ago.)2244kb.com (1 minute 6 seconds ago.)Mirsho.com (1 minute 10 seconds ago.)Exexco.com (1 minute 10 seconds ago.)

Recently Searched Keywords

puumarket (1 second ago.)mature video granny porn (1 second ago.)indian developers (7 seconds ago.)mature video granny porn (7 seconds ago.)led aydinlatma (8 seconds ago.)slbi (8 seconds ago.)boonies (9 seconds ago.)mod (13 seconds ago.)hidetitle false title (14 seconds ago.)mekar (17 seconds ago.)thay màn hình tivi (24 seconds ago.)38w (26 seconds ago.)datatable to excel c (27 seconds ago.)hippiemaiseyrahuasalt 038 stonesalt (29 seconds ago.)casolaro (31 seconds ago.)直角尺的作用 (32 seconds ago.)tn-elemdata-elem-id1490289694305top (32 seconds ago.)memorabilia store near me (36 seconds ago.)kashmasa (42 seconds ago.)style-jtqxsdvmbg (42 seconds ago.)produkte & services (46 seconds ago.)neues öbb-parkdeck in wr. neustadt (47 seconds ago.)toon (48 seconds ago.)entstehungsgeschichte (51 seconds ago.)hadnt (51 seconds ago.)rto vehicle registration (55 seconds ago.)javicar.ee (55 seconds ago.)pre-bottled cocktails (56 seconds ago.)my pony game (57 seconds ago.)7 dec (1 minute 6 seconds ago.)