Салон красоты класса люкс «Ланза Эмпатия» | Салон красоты премиум-класса в Москве

Safety: Low trust score
Year Founded: 2016
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Салон красоты класса люкс «Ланза Эмпатия» предлагает услуги окрашивания и реконструкции волос, выполняет креативные и модельные стрижки, праздничные укладки. Салон премиум-класса расположен в Москве, рядом со ст. м. «Новослободская», «Маяковская», «Менделеевская».



Domain summary

Last updated
2021-11-28
Domain label
empathystudio
Domain extension
ru
Domain registered:
2016-09-13
Domain updated:
2021-11-28
Domain expires:
2022-09-13
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Empathystudio.ru registered?
A: Empathystudio.ru was registered 5 years, 4 months, 6 days, 17 hours, 57 minutes ago on Tuesday, September 13, 2016.
Q: When was the WHOIS for Empathystudio.ru last updated?
A: The WHOIS entry was last updated 1 month, 3 weeks, 17 hours, 57 minutes ago on Sunday, November 28, 2021.
Q: What are Empathystudio.ru's nameservers?
A: DNS for Empathystudio.ru is provided by the following nameservers:
  • ns1.1gb.ru
  • ns2.1gb.ru
  • ns3.1gb-ru.com
Q: Who is the registrar for the Empathystudio.ru domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for Empathystudio.ru?
A: Empathystudio.ru has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Empathystudio.ru each day?
A: Empathystudio.ru receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Empathystudio.ru resolve to?
A: Empathystudio.ru resolves to the IPv4 address 87.236.16.33.
Q: In what country are Empathystudio.ru servers located in?
A: Empathystudio.ru has servers located in the Russia.
Q: What webserver software does Empathystudio.ru use?
A: Empathystudio.ru is powered by Nginx-reuseport/1.21.1 webserver.
Q: Who hosts Empathystudio.ru?
A: Empathystudio.ru is hosted by Beget Ltd in Russia.
Q: How much is Empathystudio.ru worth?
A: Empathystudio.ru has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Empathystudio.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Empathystudio.ru Free SEO Report

Website Inpage Analysis for Empathystudio.ru

H1 Headings

1 :
  1. Салон красоты класса люкс «Ланза Эмпатия»

H2 Headings

4 :
  1. НАШИ УСЛУГИ
  2. Эксклюзив для ваших волос от L’anza
  3. НАШИ УСЛУГИ
  4. Найдите своего мастера в салоне красоты «Ланза Эмпатия»

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

41 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-106977735-1

Links - Internal

106:

Links - Internal (nofollow)

0:

Links - Outbound

6:

Links - Outbound (nofollow)

3:

Keyword Cloud for Empathystudio.ru

100backgroundfunctionempathyformid0slidersettings0e3e3e32slidestoshowhtmldivinnerhtml htmldivcsshtmldivdfdvcardwrapfhtmldivinnerhtmlcurrent 1chtmldivcss0px 0pxonsuccess function1 slidestoscroll 1currenttrue onsuccess functioninfoempathystudiorumodalvartruesettings slidestoshow 1settings slidestoshowmodal trueonsuccessstudiorevolutiontotalslidesvar htmldivincludebreakpoint0e3e3e3 100background0pxslidestoscrollslidestoshow 1lanza3true onsuccessmodal true onsuccesselse1errormessage1 slidestoscrollslidestoscroll 1lanza empathyslidestoshow 1 slidestoscrolljqueryempathy studiocurrentslideif

Who hosts Empathystudio.ru?

Empathystudio.ru Hosting Provider Information

Hosted IP Address:87.236.16.33
Hosted Hostname:87.236.16.33
Service Provider:Beget Ltd
Hosted Country:RussiaRU
Location Latitude:55.7386
Location Longitude:37.6068
Webserver Software:nginx-reuseport/1.21.1

Is "Beget Ltd" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%
Beget Ltd
0.0749%

HTTP Header Analysis for Empathystudio.ru

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx-reuseport/1.21.1
Date: Sun, 28 Nov 2021 14:57:37 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 27517
Connection: keep-alive
Keep-Alive: timeout=30
X-Powered-By: PHP/5.6.40
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Link:; rel=shortlink
Vary: Accept-Encoding
Content-Encoding: gzip

Empathystudio.ru Domain Nameserver Information

HostIP AddressCountry
ns1.1gb.ru 81.177.24.54
ns2.1gb.ru 195.161.112.91
ns3.1gb-ru.com 94.249.192.249


Need to find out who hosts Empathystudio.ru?


Domain Registration (WhoIs) information for Empathystudio.ru

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: EMPATHYSTUDIO.RU
nserver: ns1.1gb.ru.
nserver: ns2.1gb.ru.
nserver: ns3.1gb-ru.com.
state: REGISTERED, DELEGATED, UNVERIFIED
person: Private Person
registrar: RU-CENTER-RU
admin-contact: https://www.nic.ru/whois
created: 2016-09-13T16:32:32Z
paid-till: 2022-09-13T16:32:32Z
free-date: 2022-10-14
source: TCI

Last updated on 2021-11-28T14:56:30Z

Websites with Similar Names

Empat-consulting.online
Build a Free Website - Website Builder
Empat-services.online
Build a Free Website - Website Builder
Empat.cc
Empat.cc - Эмоциональный патиссон
Empat.tech
Empat – Mobile application, Web and Software Development
Empatbersaudara.com
Empatbersaudara
Empatbiri.net
Empat Biri - Ruhunu Şifalandır

Recently Updated Websites

Unclelife.com (7 seconds ago.)Mexiburritos.com (9 seconds ago.)Setiplast.ru (11 seconds ago.)Faisunveux.com (14 seconds ago.)Vatexbh.com (14 seconds ago.)24saatkurye.com (19 seconds ago.)Greengineering.pro (20 seconds ago.)Ugmed.ru (24 seconds ago.)Cokt.com (26 seconds ago.)Webguerillas.de (32 seconds ago.)Cucinasenzasenza.com (33 seconds ago.)Piaonane.com (33 seconds ago.)Mvdrycleaners.com (38 seconds ago.)Quickflip.info (40 seconds ago.)Humblecc.com (41 seconds ago.)Umbrellabaytherapy.com (43 seconds ago.)Lac-renaud.ca (44 seconds ago.)Cn-hc.net (46 seconds ago.)Wwpp7.com (54 seconds ago.)Whisperingborealis.com (54 seconds ago.)Fundacionbca.com (54 seconds ago.)Tallybh.com (55 seconds ago.)Medicaldeviceinsurance.nyc (57 seconds ago.)Veronarevestimientos.com (58 seconds ago.)Indofinpay.net (59 seconds ago.)Douyushepin.com (1 minute 3 seconds ago.)Cooprise.com (1 minute 5 seconds ago.)Jesushatesliberals.com (1 minute 8 seconds ago.)Banffquebec.ca (1 minute 9 seconds ago.)Bare-ass-spanking.com (1 minute 9 seconds ago.)

Recently Searched Keywords

amateur blowjob (1 second ago.)кровати медицинские (4 seconds ago.)vacation packages around (5 seconds ago.)wankie+coal+mine (5 seconds ago.)mindedness (7 seconds ago.)mulumim pentru comand (8 seconds ago.)jugado (10 seconds ago.)dating site (13 seconds ago.)tagm16fcatfontsettingsm16fcatfontfamilym16fcatfontsizem16fcatfontlineheightm16fcatfontstylem16fcatfontweightm16fcatfonttransformm16fcatfontspacingm16fcatm16fmetafonttitlearticle meta (18 seconds ago.)yeleri 9660av perihan (18 seconds ago.)font-familynunito sansfont-weight700 media (20 seconds ago.)data-slice-typebuttons asqs-slide-wrapperdata-slide-typecover-page (22 seconds ago.)leonardo da vinci (26 seconds ago.)stillsnabha (27 seconds ago.)salvare (31 seconds ago.)txtv100 (32 seconds ago.)company name (32 seconds ago.)socios (33 seconds ago.)Pakwan (49 seconds ago.)عن الموقع (50 seconds ago.)qu’est-ce que le seo on-page, le seo on-site et le seo off-site  (53 seconds ago.)asia gaming (55 seconds ago.)boat storage (58 seconds ago.)menswear (1 minute 1 second ago.)accompanist meaning and synonyms (1 minute 5 seconds ago.)width360px 300 (1 minute 6 seconds ago.)050-730-36724 140105 (1 minute 6 seconds ago.)goodshop reviews (1 minute 7 seconds ago.)zwitsal baby cream (1 minute 7 seconds ago.)juliabeng1 (1 minute 8 seconds ago.)